CD272, also known as BTLA (B- and T-lymphocyte attenuator), is a single pass type I transmembrane glycoprotein that belongs to the CD28/CTLA4 family of the Ig superfamily. Like CD28 and CTLA4, CD272 contains one Ig-like domain in the extracellular region. However, the Ig-like domain is an I­type rather than a V­type domain commonly found in other family members. CD272 also differs from other CD28/CTLA4 family members through the interaction of its Ig-like domain with the TNF superfamily member, HVEM (TNFRSF14) rather than with B7 family ligands. CD272 is an immune co-inhibitory molecule expressed on T cells, B cells and, macrophages, dendritic and NK cells.  The HVEM-CD272 ligation relays inhibitory signals to suppress the immune response. Expression of CD272 is low in naïve T cells and increased during antigen­specific induction of anergy. In B cells, BTLA is highest when cells are mature and naïve. BTLA appears to limit T cell numbers, since deletion of BTLA results in overproduction of T cells, especially CD8+ memory T cells in mice.  There are two ITIM motifs and three Tyr phosphorylation sites in the cytoplasmic tail of CD272  that mediate inhibitory signaling.   Polymorphisms in the CD272 gene have been associated with an increased risk of rheumatoid arthritis. 

CD272, also known as BTLA (B- and T-lymphocyte attenuator), is a single pass type I transmembrane glycoprotein that belongs to the CD28/CTLA4 family of the Ig superfamily. Like CD28 and CTLA4, CD272 contains one Ig-like domain in the extracellular region. However, the Ig-like domain is an I­type rather than a V­type domain commonly found in other family members. CD272 also differs from other CD28/CTLA4 family members through the interaction of its Ig-like domain with the TNF superfamily member, HVEM (TNFRSF14) rather than with B7 family ligands. CD272 is an immune co-inhibitory molecule expressed on T cells, B cells and, macrophages, dendritic and NK cells.  The HVEM-CD272 ligation relays inhibitory signals to suppress the immune response. Expression of CD272 is low in naïve T cells and increased during antigen­specific induction of anergy. In B cells, BTLA is highest when cells are mature and naïve. BTLA appears to limit T cell numbers, since deletion of BTLA results in overproduction of T cells, especially CD8+ memory T cells in mice.  There are two ITIM motifs and three Tyr phosphorylation sites in the cytoplasmic tail of CD272  that mediate inhibitory signaling.   Polymorphisms in the CD272 gene have been associated with an increased risk of rheumatoid arthritis. 

 

Product Details

 

Gene Symbol: CD272; BTLA; BTLA1; BTLA-1

 

NCBI Gene ID: 151888

 

Uniprot Entry: Q7Z6A9

 

Construct Details: The recombinant human CD272-Fc fusion protein is expressed as a 350 amino acid protein consisting of Lys31 - Pro152 region of CD272 (UniProt accession #Q7Z6A9) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

 

Source:  Human cells stably expressing CD272-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFE

PVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMASRPSTGTHTCPPCPAPELLGGPSVFLF

PPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNG

KEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPEN

NYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

M.W.: Calculated molecular mass 39.6 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation

 

Calculated PI: 6.64

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm):  53120

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds human HVEM/TNFRSF14 and blocks HVEM-CD272 mediated signaling activity.

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for at least 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nat. Immunol. 4:670 (2003). 

2. J. Biol. Chem. 280:39553 (2005). 

3. Nat. Immunol. 6:90 (2005). 

4. J. Immunol. 174:3377 (2005). 

5. Nat. Rev. Immunol. 6:671 (2006).

 

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0722B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.