SLAMF2 (signaling lymphocytic activation molecule family member2), also known as BLAST­1 and CD48, is a GPI­anchored glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF2 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region. SLAMF2 is expressed on most lineage­committed hematopoietic cells but not on hematopoietic stem cells or progenitors. CD48 plays important roles in a variety biological processes including adhesion, pathogen recognition, cellular activation, and cytokine regulation, and emerges as a critical effector molecule in immune responses. CD2, SLAMF4 (also known as 2B4 and CD244), and heparan sulfate function as CD48 ligands. In mice, CD48­CD2 interactions promote T cell activation and class switching to IgG2a in B cells.  In human, high affinity CD48­CD244 interactions can either promote or inhibit NK cell and cytotoxic T cell (CTL) activation. A soluble form of CD48 is detected in the serum of lymphoid leukemia and arthritis patients.

SLAMF2 (signaling lymphocytic activation molecule family member2), also known as BLAST­1 and CD48, is a GPI­anchored glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF2 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region. SLAMF2 is expressed on most lineage­committed hematopoietic cells but not on hematopoietic stem cells or progenitors. CD48 plays important roles in a variety biological processes including adhesion, pathogen recognition, cellular activation, and cytokine regulation, and emerges as a critical effector molecule in immune responses. CD2, SLAMF4 (also known as 2B4 and CD244), and heparan sulfate function as CD48 ligands. In mice, CD48­CD2 interactions promote T cell activation and class switching to IgG2a in B cells.  In human, high affinity CD48­CD244 interactions can either promote or inhibit NK cell and cytotoxic T cell (CTL) activation. A soluble form of CD48 is detected in the serum of lymphoid leukemia and arthritis patients.

 

Product Details

 

Gene Symbol: SLAMF2; CD48; BCM1; BLAST; hCD48; mCD48; BLAST1; BLAST-1; SLAMF-2; MEM-102

 

NCBI Gene ID: 962

 

Uniprot Entry: P09326

 

Construct Details: The recombinant human SLAMF2-Fc fusion protein is expressed as a 421-amino acid protein consisting of Gln27 - Arg219 region of SLAMF2 (UniProt accession #P09326) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human SLAMF2-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

QGHLVHMTVVSGSNVTLNISESLPENYKQLTWFYTFDQKIVEWDSRKSKYFESKFKGRVRLDPQSGALYISKVQK

EDNSTYIMRVLKKTGNEQEWKIKLQVLDPVPKPVIKIEKIEDMDDNCYLKLSCVIPGESVNYTWYGDKRPFPKEL

QNSVLETTLMPHNYSRCYTCQVSNSVSSKNGTVCLSPPCTLARSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTL

MISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNK

ALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSD

GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 47.8; Estimated by SDS-PAGE under reducing condition (kDa): 60-70

 

Calculated PI: 8.44

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 73060

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized SLAMF2 interacts heterophilically with CD2 and SLAMF4/CD244/2B4 (SKU#FCL0791)

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Exp. Med. 171: 2115-2130 (1990).

2. J. Exp. Med. 176:1241 (1992).  

3. J Immunol. 159 (8): 3910-3920 (1997).

4. J. Clin. Immunol. 17:502 (1997). 

5. Cell 121:1109 (2005).  

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0449-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.