Programmed death-1 (PD-1), also known as programmed cell death 1 (PDCD1) or CD279, is a single pass type I transmembrane glycoprotein of the Ig superfamily. It is an immunoreceptor in the CD28/CTLA-4 family with an IgV-type extracellular domain showing 21–33% sequence identity with CTLA-4, CD28 and ICOS. Members of the CD28/CTLA-4 family have been shown to either promote T cell activation (CD28 and ICOS) or inhibit T cell activation (CTLA4 and PD1). The cytoplasmic domain of PD-1 contains two tyrosine residues, a membrane-proximal immunoreceptor tyrosine-based inhibitory motif (ITIM) and an immunoreceptor tyrosine-based switch motif (ITSM). ITIM is widely found in immunoinhibitory receptors and the membrane-proximal tyrosine residue may play a central role for the inhibitory function of PD-1. PD-1 negatively regulates antigen receptor signaling by recruiting protein tyrosine phosphatase upon engaging with either of two ligands, PD-L1 or PD-L2. It inhibits the T-cell proliferation and production of related cytokines such as IL-1, IL-4, IL-10 and IFN-γ. PD-1 is involved in lymphocyte clonal selection and peripheral tolerance, and thus contributes to the prevention of autoimmune diseases. As a negative regulator of T- cell effector mechanisms, PD-1 may lead to suppression of anti-tumor immunity. Blockade of PD-1 inhibitory activity with antibodies enhances anti-tumor immunity in vivo. PD-1 has been proposed as a promising target for cancer immunotherapy.
Gene Symbol: PD-1; CD279, PDCD1, PD1, SLEB2, hPD-1, hPD-l, hSLE1
NCBI Gene ID: 5133
Uniprot Entry: Q15116
Construct Details: The recombinant protein is expressed as a 376-amino acid protein consisting of Pro21 - Thr168 region of PD-1 or CD279 (UniProt accession #Q15116) and a C-terminal Fc from human IgG1, which exists as a homodimer under non-reducing conditions.
Source: Human cells stably expressing PD-1-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
PGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRMSPSNQTDKLAAFPEDRSQPGQDCRFR
VTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKAQIKESLRAELRVTERRAEVPTAHPSPSPRPAGQFQTSTGT
HTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST
YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS
DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass 42.1 kDa; estimated by SDS-PAGE under reducing condition 60-65 kDa probably due to glycosylation.
Calculated PI: 8.73
Calculated Extinction Coefficients (M-1 cm-1, at 280nm): 55,390
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier- and preservative-free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds to its ligands PD-L1 (SKU#: FCL0781), PD-L2 (SKU#FCL783) and anti-PD-1 monoclonal antibodies (SKU#: MAB1732, MAB0761, MAB0763). Blocks PD-1’s binding to its ligands, PD-L1 and PD-L2 and their signaling activities. Shows cross-species binding to both human and mouse PD-L1 (SKU#FCL1846) and PD-L2 (SKU#FCL1818) in a functional ELISA (see Technical Data). Exhibits immunosuppressive activity in vivo.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Technical Data 1: Determination of Binding Affinity to Human PD-L1 by ELISA
Recombinant PD-1-Fc protein (SKU#FCL0763) and Fc protein alone (SKU#FCL0029) was immobilized at 100 ng/well on a 96-well NuncMaxisorp plate for a functional ELISA with serially diluted biotinylated PD-L1-Fc protein (SKU#FCL0781B). Fc protein alone was used as a negative control to demonstrate the specificity of PD-1:PD-L1 binding under the experimental conditions. The binding curve was fit and KD (the concentration of 50% of max binding) was calculated for PD-1: PD-L1 binding to be 495 ± 74 ng/ml with a linear binding range between 100 and 3000 ng/ml.
Technical Data 2: Determination of Binding Affinity to Human PD-L2 by ELISA
Recombinant PD-1-Fc protein (SKU#FCL0763) and Fc protein alone (SKU#FCL0029) was immobilized at 100 ng/well on a 96-well NuncMaxisorp plate for a functional ELISA with serially diluted biotinylated PD-L2-Fc protein (SKU#FCL0783B). Fc protein alone was used as a negative control to demonstrate the specificity of PD-1:PD-L2 binding under the experimental conditions. The binding curve was fit and KD (the concentration of 50% of max binding) was calculated for PD-1: PD-L2 binding to be 98 ± 4 ng/ml with a linear binding range between 25 and 400 ng/ml. In comparison, PD-L2 binds to PD-1 with 4-5 fold higher affinity than PD-L1 does.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for at least 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. EMBO J. 11:3887, 1992
2. Genomics 23:704-706, 1994
3. Genes Immun. 6:430-437, 2005
4. Immunol. Rev. 229:114-25, 2009
Product datasheet (pdf) can be downloaded here: FCL0763-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services