Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human KDR protein (extracellular domain), recombinant

Product ID: KDR ECD (SKU#: FCL1488)

For Bulk Order: Call for price

Price:
$627.00
Size

Description

Vascular endothelial cell growth factors (VEGFs) are secreted polypeptides with a highly conserved cystine-knot structure similar to that of the platelet-derived growth factors (PDGFs).  VEGFs play important roles in vascular development and in diseases involving abnormal growth of blood vessels such as tumor-related angiogenesis. VEGFs stimulate angiogenesis by binding to the specific receptors (VEGFRs) on the surface of vascular endothelial cells. All the three VEGFRs, VEGFR1 (Flt-1), VEGFR2 (KDR/Flk-1/CD309), and VEGFR3 (Flt-4), belong to the CSF-1/PDGF receptor subfamily of receptor tyrosine kinase superfamily (RTKs). Each VEGFR contains 7 immunoglobulin (Ig)-like C2-type domains in the extracellular region and an intracellular kinase domain.  VEGFR2 is thought to be the primary inducer of VEGF-mediated blood vessel growth.  It acts as a cell-surface receptor for VEGFA, VEGFC and VEGFD with an essential role in the regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. VEGFR2 is monomeric in the absence of ligands and exists as a dimer in the presence of bound VEGF ligands.  It can also form heterodimers with VEGFR1 and VEGFR3. VEGFR2 is also known as an early marker for endothelial cell progenitors, whose expression is restricted to endothelial cells. VEGFR-2-mediated signaling promotes proliferation, survival, migration and differentiation of endothelial cells.  Mutations of vegfr2 are implicated in infantile capillary hemangiomas. Targeting VEGF/VEGFR signal transduction pathways has shown therapeutic benefits in multiple diseases.

 

Vascular endothelial cell growth factors (VEGFs) are secreted polypeptides with a highly conserved cystine-knot structure similar to that of the platelet-derived growth factors (PDGFs).  VEGFs play important roles in vascular development and in diseases involving abnormal growth of blood vessels such as tumor-related angiogenesis. VEGFs stimulate angiogenesis by binding to the specific receptors (VEGFRs) on the surface of vascular endothelial cells. All the three VEGFRs, VEGFR1 (Flt-1), VEGFR2 (KDR/Flk-1/CD309), and VEGFR3 (Flt-4), belong to the CSF-1/PDGF receptor subfamily of receptor tyrosine kinase superfamily (RTKs). Each VEGFR contains 7 immunoglobulin (Ig)-like C2-type domains in the extracellular region and an intracellular kinase domain.  VEGFR2 is thought to be the primary inducer of VEGF-mediated blood vessel growth.  It acts as a cell-surface receptor for VEGFA, VEGFC and VEGFD with an essential role in the regulation of angiogenesis, vascular development, vascular permeability, and embryonic hematopoiesis. VEGFR2 is monomeric in the absence of ligands and exists as a dimer in the presence of bound VEGF ligands.  It can also form heterodimers with VEGFR1 and VEGFR3. VEGFR2 is also known as an early marker for endothelial cell progenitors, whose expression is restricted to endothelial cells. VEGFR-2-mediated signaling promotes proliferation, survival, migration and differentiation of endothelial cells.  Mutations of vegfr2 are implicated in infantile capillary hemangiomas. Targeting VEGF/VEGFR signal transduction pathways has shown therapeutic benefits in multiple diseases.

 

Product Details

 

Gene Symbol: KDR; CD309; FLK1; FLK-1; VEGFR2; VEGFR-2; VEGFR

 

NCBI Gene ID: 3791

 

Uniprot Entry: P35968

 

Construct Details: The recombinant human KDR/VEGFR2/CD309 extracellular or ecto-domain (ECD) is expressed as a 756 amino acid protein consisting of Ala20 - Glu764 region of KDR and a C-terminal His-tag.  It contains 18 potential N-linked glycosylation sites.

 

Source:  Human cells stably expressing KDR/VEGFR2/CD309 ECD and growing in chemical-defined media with no animal components or antibiotics.

 

Deduced Amino Acid Sequence:

ASVGLPSVSLDLPRLSIQKDILTIKANTTLQITCRGQRDLDWLWPNNQSGSEQRVEVTECSDGLFCKTLTIPKVIGNDTGAYKCFYRETD

LASVIYVYVQDYRSPFIASVSDQHGVVYITENKNKTVVIPCLGSISNLNVSLCARYPEKRFVPDGNRISWDSKKGFTIPSYMISYAGMVF

CEAKINDESYQSIMYIVVVVGYRIYDVVLSPSHGIELSVGEKLVLNCTARTELNVGIDFNWEYPSSKHQHKKLVNRDLKTQSGSEMKKFL

STLTIDGITRSDQGLYTCAASSGLMTKKNSTFVRVHEKPFVAFGSGMESLVEATVGERVRIPAKYLGYPPPEIKWYKNGIPLESNHTIKA

GHVLTIMEVSERDTGNYTVILTNPISKEKQSHVVSLVVYVPPQIGEKSLISPVDSYQYGTTQTLTCTVYAIPPPHHIHWYWQLEEECANE

PSHAVSVTNPYPCEEWRSVEDFQGGNKIEVNKNQFALIEGKNKTVSTLVIQAANVSALYKCEAVNKVGRGERVISFHVTRGPEITLQPDM

QPTEQESVSLWCTADRSTFENLTWYKLGPQPLPIHVGELPTPVCKNLDTLWKLNATMFSNSTNDILIMELKNASLQDQGDYVCLAQDRKT

KKRHCVVRQLTVLERVAPTITGNLENQTTSIGESIEVSCTASGNPPPQIMWFKDNETLVEDSGIVLKDGNRNLTIRRVRKEDEGLYTCQA

CSVLGCAKVEAFFIIEGAQEKTNLESTGHHHHHHHH

 

M.W.: Calculated molecular mass (kDa): 84.6; Estimated by SDS-PAGE under reducing condition (kDa): 110-120 (see the gel image) suggesting that the protein is glycosylated

 

Calculated PI: 6.39

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm):  110460

 

Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC)

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Oncogene 6:1677-1683(1991)

2. Biochem. Biophys. Res. Commun. 187: 1579-1586 (1992)

3. J. Biol. Chem. 270:23111-23118 (1995)

4. J. Biol. Chem. 279:22267-22275 (2004)

5. Nat. Med. 15:1023-1030(2009)

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1488-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class Receptor Tyrosine Kinase (RTK)
Gene Family Tyrosine Protein Kinase Family; CSF-1/PDGF Receptor Subfamily
Gene Synonym CD309; FLK1; FLK-1; VEGFR2; VEGFR-2; VEGFR
Research Area Cancer
"A" - "Z" List
K
CD Antigen CD309
Pathway/Disease VEGF Signaling Pathway
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services