SLAMF6 (signaling lymphocytic activation molecule family member5), also known as NTB-A and CD352, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF6 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF6 is expressed on the surface of NK, T, and B cells as well as eosinophils. It associates homophilically through weak interactions between the Ig­like V-type domains. SLAMF6 functions as an activating co-receptor on NK and T cells. Tyrosine phosphorylation in the membrane proximal ITSM enables specific association with the adaptor molecules, leading to SLAMF6 mediated cytotoxicity of NK cells and the production of IFN­γ by NK cells. SLAMF6 may also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.SLAMF6 deficient mice show weakened Th2 responses and elevated levels of neutrophil­derived inflammatory mediators. On B cells, SLAMF6 modulates Ig class switching and the balance between tolerance and autoimmunity.  

SLAMF6 (signaling lymphocytic activation molecule family member5), also known as NTB-A and CD352, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF6 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 2 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF6 is expressed on the surface of NK, T, and B cells as well as eosinophils. It associates homophilically through weak interactions between the Ig­like V-type domains. SLAMF6 functions as an activating co-receptor on NK and T cells. Tyrosine phosphorylation in the membrane proximal ITSM enables specific association with the adaptor molecules, leading to SLAMF6 mediated cytotoxicity of NK cells and the production of IFN­γ by NK cells. SLAMF6 may also mediate inhibitory signals in NK cells from X-linked lymphoproliferative patients.SLAMF6 deficient mice show weakened Th2 responses and elevated levels of neutrophil­derived inflammatory mediators. On B cells, SLAMF6 modulates Ig class switching and the balance between tolerance and autoimmunity.  

 

Product Details

 

Gene Symbol: SLAMF6; SLAMF-6; CD352; KALI; NTBA; KALIb; Ly108; NTB-A; SF2000; UNQ6123/PRO20080

 

NCBI Gene ID: 114836

 

Uniprot Entry: Q96DU3

 

Construct Details: The recombinant human SLAMF6-Fc fusion protein is expressed as a 432-amino acid protein consisting of Gln22 - Lys225 region of SLAMF6 (UniProt accession #Q96DU3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

  

Source: Human cells stably expressing human SLAMF6-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

QSSLTPLMVNGILGESVTLPLEFPAGEKVNFITWLFNETSLAFIVPHETKSPEIHVTNPKQGKRLNFTQSYSL

QLSNLKMEDTGSYRAQISTKTSAKLSSYTLRILRQLRNIQVTNHSQLFQNMTCELHLTCSVEDADDNVSFRWE

ALGNTLSSQPNLTVSWDPRISSEQDYTCIAENAVSNLSFSVSAQKLCEDVKIQYTDTKSTGTHTCPPCPAPEL

LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLT

VLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE

WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 48.5; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

 

Calculated PI: 6.30

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 59985

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized SLAMF6 interacts homophilically with SLAMF6 in a functional ELISA

 

 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Exp. Med. 194:235 (2001).  

2. Immunogenetics 53:843 (2002).  

3. J Biol. Chem. 279: 18662 (2004).

4. Immunity 25:559 (2006).  

5. Science 312:1665 (2006).  

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0420B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.