
SLAMF4 (signaling lymphocytic activation molecule family member 4), also known as 2B4 and CD244, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF4 contains 2-4 Ig-like domains in the extracellular region and 4 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF4 interacts with SLAMF2/CD48, while other SLAM family proteins bind homophilically. SLAMF4 is implicated in the regulation of natural killer (NK) and T lymphocyte function. SLAMF4 is expressed on all NK cells, γδ T cells, monocytes, some CD4+ and CD8+ T cells, and some dendritic cells. CD48 mediates SLAMF4+ cell interactions with nearly all hematopoietic cell types. SLAMF4/CD48 signaling cooperates with other receptor systems to either promote or inhibit NK and CD8+ T cell activation. Ligation of SLAMF4 with antibodies or CD48 can either directly trigger inhibitory signaling or disrupt an inhibitory interaction, leading to cellular activation. SLAMF4 can effectively activate and enhance NK cell–mediated cytotoxicity, secretion of IFN-γ and matrix metalloproteinases (MMPs). The inhibitory effect is associated with the long form of SLAMF4, while the activation is associated with the short form.
Gene Symbol: SLAMF4; CD244; 2B4; h2B4; NAIL; Nmrk; NKR2B4; SLAMF-4
NCBI Gene ID: 51744
Uniprot Entry: Q9BZW8
Construct Details: The recombinant human SLAMF4 ECD protein is expressed as a 431-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells stably expressing human SLAMF4-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK
AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK
LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGTHTCPPCPAPELLGGP
SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD
WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ
PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75
Calculated PI: 7.65
Calculated extinction coefficients (M-1 cm-1, at 280nm): 71110
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 (SKU#FCL0449) in a functional ELISA
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. J. Exp. Med. 188 : 2083-2090 (1998).
2. J. Immunol. 151: 60-70. (1993).
3. J. Immunol. 173:174 (2004).
4. J. Immunol. 175 : 2045-2049 (2005)..
5. Blood 107: 3181-3188 (2006).
Product datasheet (pdf) can be downloaded here: FCL0791-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services