Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human SLAMF1 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Product ID: SLAMF1-Fc-Biot (SKU#: FCL0465B)

For Bulk Order: Call for price

Price:
$548.00
Size

Description

SLAMF1 (signaling lymphocytic activation molecule family member1), also known as SLAM and CD150, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF1 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 3 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF1 is expressed on lymphocytes, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells.  Its expression is up­regulated on lymphocytes cells after activation. As a self-ligand, SLAMF1 plays an important role in bidirectional T-cell to B-cell stimulation.  It performs diverse immunologic functions including T/B-cell costimulation, induction of interferon-γ in Th1 T-cell clones, redirection of Th2 clones to a Th1 or Th0 phenotype, and inhibition of apoptosis in B cells. SLAMF1 ligation also promotes an allergen­induced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages. In human, SLAMF1 also functions as a cellular entry receptor for measles virus.

 

SLAMF1 (signaling lymphocytic activation molecule family member1), also known as SLAM and CD150, is a single-pass type I transmembrane glycoprotein that belongs to the SLAM subfamily of the CD2 protein family of the Ig (immunoglobulin) superfamily. Most SLAM family members function as adhesion molecules and co-receptors for lymphocyte activation and mediate tyrosine phosphorylation signals. SLAMF1 contains 1 Ig-like V-type and 1 Ig-like C2-type domains in the extracellular region and 3 ITSM (immunoreceptor tyrosine switch motifs) in the cytoplasmic region. SLAMF1 is expressed on lymphocytes, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells.  Its expression is up­regulated on lymphocytes cells after activation. As a self-ligand, SLAMF1 plays an important role in bidirectional T-cell to B-cell stimulation.  It performs diverse immunologic functions including T/B-cell costimulation, induction of interferon-γ in Th1 T-cell clones, redirection of Th2 clones to a Th1 or Th0 phenotype, and inhibition of apoptosis in B cells. SLAMF1 ligation also promotes an allergen­induced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages. In human, SLAMF1 also functions as a cellular entry receptor for measles virus.

 

Product Details

 

Gene Symbol: SLAMF1; CD150; SLAM; CDw150; IPO-3; SLAMF-1

 

NCBI Gene ID: 6504

 

Uniprot Entry: Q13291

 

Construct Details: The recombinant human SLAMF1-Fc fusion protein is expressed as a 445-amino acid protein consisting of Ala21 - Pro237 region of SLAMF1 (UniProt accession #Q13291) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human SLAMF1-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

ASYGTGGRMMNCPKILRQLGSKVLLPLTYERINKSMNKSIHIVVTMAKSLENSVENKIVSLDPSEAGPPRYLGDRYK

FYLENLTLGIRESRKEDEGWYLMTLEKNVSVQRFCLQLRLYEQVSTPEIKVLNKTQENGTCTLILGCTVEKGDHVAY

SWSEKAGTHPLNPANSSHLLSLTLGPQHADNIYICTVSNPISNNSQTFSPWPGCRTDPSETKPSTGTHTCPPCPAPE

LLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH

QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQP

ENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 49.9; Estimated by SDS-PAGE under reducing condition (kDa): 65-75

 

Calculated PI: 8.17

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  66070

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Co-stimulates IL-4 secretion by  T cells in the presence of anti-CD3e antibody

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nature 376: 260-263 (1995).

2. Nature 406: 893-897 (2000).

3. Nature Immunol. 4: 19-24 (2003).

4. J. Exp. Med. 185:993 (1997).  

5. J. Immunol. 158:4036 (1997).  

 



 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0465B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-Pass Type I Transmembrane
Gene Synonym CD150; SLAM; CDw150; IPO-3; SLAMF-1
Gene Family Ig Superfamily; CD2/SLAM Family
Research Area Immunology
"A" - "Z" List
S
Pathway/Disease Cell Adhesion
Species
Human
CD Antigen CD150

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services