NECL5 (Nectin-like protein 5), also known as PVR (poliovirus receptor) and CD155, is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily.  Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL5 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL5 is predominately expressed in enterocytes and gastrointestinal lymphatic tissues.  It was originally identified by the ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. The normal cellular function of NECL5 maybe the involvement of intercellular adhension between epithelial, endothelial, and immune cells. NECL5 interact with CD226 and CD96, which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. Enhanced NECL5 expression in tumor cells contributes to loss of contact inhibition and increased migration. It also allows tumor cell recognition and killing by CD226­ or CD96­expressing NK cells. NECL5 also binds the inhibitory ligand TIGIT (T-cell immunoreceptor with Ig and ITIM domains) on NK and some mature T cells, antagonizing CD226 effects.

NECL5 (Nectin-like protein 5), also known as PVR (poliovirus receptor) and CD155, is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily.  Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL5 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that interacts either with other CAMs of the same kind (homophilic binding) or with other CAMs or the extracellular matrix (heterophilic binding) in a Ca2+-independent manner. NECL5 is predominately expressed in enterocytes and gastrointestinal lymphatic tissues.  It was originally identified by the ability to mediate the cell attachment and entry of poliovirus (PV), an etiologic agent of the central nervous system disease poliomyelitis. The normal cellular function of NECL5 maybe the involvement of intercellular adhension between epithelial, endothelial, and immune cells. NECL5 interact with CD226 and CD96, which promote the adhension, migration and NK-cell killing, and thus efficiently prime cell-mediated tumor-specific immunity. Enhanced NECL5 expression in tumor cells contributes to loss of contact inhibition and increased migration. It also allows tumor cell recognition and killing by CD226­ or CD96­expressing NK cells. NECL5 also binds the inhibitory ligand TIGIT (T-cell immunoreceptor with Ig and ITIM domains) on NK and some mature T cells, antagonizing CD226 effects.

 

Product Details

 

Gene Symbol: NECL5; CD155; PVR; PVS; HVED; NECL-5; TAGE4; Necl-5

 

NCBI Gene ID: 5817

 

Uniprot Entry: P15151

 

Construct Details: The recombinant human NECL5-Fc fusion protein is expressed as a 552-amino acid protein consisting of Trp21 - Asn343 region of NECL5 (UniProt accession #15151 and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human NECL5-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESK

RLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEP

VPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEK

PQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR

PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNGSTGTHTCPPCPAPELLGGPSVFLFPP

KPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLN

GKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNG

QPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 60.7; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

 

Calculated PI: 6.26

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 86580

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized NECL5 interacts with CD226 (SKU#FCL1028) in a functional ELISA

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Biol. Chem. 278:31251 (2003). 

2. J. Exp. Med. 199:1331 (2004). 

3. Eur. J. Immunol. 37 :2214 (2007).

4. Proc. Natl. Acad. Sci. 106:17858 (2009).

 5. J. Immunol. 184:902 (2010). 

 

  

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1077B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.