NECL2 (Nectin-like protein 2), also known as IgSF4 and CADM1 (cell adhesion molecule 1), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily.  Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL2 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that mediates calcium-independent adhesive interactions, either homophilic or heterophilic with CRTAM (class I­restricted T cell­associated molecule), Necl­1 or Nectin­3. NECL2 is found on mast cells, neurons, and dendritic cells. Necl2 is also known s TSLC­1 (tumor suppressor in lung cancer­1).  It is downregulated in non­small cell lung cancer. This may allow evasion of antitumor responses, as NECL2 interacts with CRTAM on activated NK and CD8+ T cells and stimulates cytotoxicity. NECL2 binds homotypically across synaptic clefts and promotes formation of neural cell synapses. Expression on mast cells allows attachment to neurites and fibroblasts. NECL2 contains a cytoplasmic domain with protein 4.1 and PDZ domain binding sites, allowing connections to adaptor molecules that are critical for synaptogenesis. 

NECL2 (Nectin-like protein 2), also known as IgSF4 and CADM1 (cell adhesion molecule 1), is a single pass type I transmembrane glycoprotein that belongs to the Nectin family of the Ig (immunoglobulin) superfamily.  Most Nectin family members function as cell adhesion molecules (CAMs) located on the cell surface and involved with the binding with other cells or with the extracellular matrix (ECM). Like other Nectin members, NECL2 contains 1 Ig-like V-type domain and 2 Ig-like C2-type domains in the extracellular region that mediates calcium-independent adhesive interactions, either homophilic or heterophilic with CRTAM (class I­restricted T cell­associated molecule), Necl­1 or Nectin­3. NECL2 is found on mast cells, neurons, and dendritic cells. Necl2 is also known s TSLC­1 (tumor suppressor in lung cancer­1).  It is downregulated in non­small cell lung cancer. This may allow evasion of antitumor responses, as NECL2 interacts with CRTAM on activated NK and CD8+ T cells and stimulates cytotoxicity. NECL2 binds homotypically across synaptic clefts and promotes formation of neural cell synapses. Expression on mast cells allows attachment to neurites and fibroblasts. NECL2 contains a cytoplasmic domain with protein 4.1 and PDZ domain binding sites, allowing connections to adaptor molecules that are critical for synaptogenesis. 

 

Product Details

 

Gene Symbol: NECL2; CADM1; BL2; ST17; IGSF4; RA175; TSLC1; IGSF4A; Necl-2; SYNCAM; sgIGSF; sTSLC-1; synCAM1; TSLC-1

 

NCBI Gene ID: 23705

 

Uniprot Entry: Q9BY67

 

Construct Details: The recombinant human NECL2-Fc fusion protein is expressed as a 531-amino acid protein consisting of Gln451 - His346 region of NECL2 (UniProt accession #Q9BY67 - isoform 5) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human NECL2-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

QNLFTKDVTVIEGEVATISCQVNKSDDSVIQLLNPNRQTIYFRDFRPLKDSRFQLLNFSSSELK

VSLTNVSISDEGRYFCQLYTDPPQESYTTITVLVPPRNLMIDIQKDTAVEGEEIEVNCTAMASK

PATTIRWFKGNTELKGKSEVEEWSDMYTVTSQLMLKVHKEDDGVPVICQVEHPAVTGNLQTQRY

LEVQYKPQVHIQMTYPLQGLTREGDALELTCEAIGKPQPVMVTWVRVDDEMPQHAVLSGPNLFI

NNLNKTDNGTYRCEASNIVGKAHSDYMLYVYDSRAGEEGSIRAVDHGSTGTHTCPPCPAPELLG

GPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTY

RVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVS

LTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVM

HEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 59.8; Estimated by SDS-PAGE under reducing condition (kDa): 70-80

 

Calculated PI: 5.49

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  70540

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free)

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized NECL2 binds CRTAM/CD355 (SKU#FCL1027) in a functional ELISA

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Science 297:1525 (2002).  

2. Nat. Genet. 27:427 (2002).  

3. J. Biol. Chem. 278:35421 (2003).  

4. Oncogene 23:5687 (2004). 

5. J. Immunol. 174:6934 (2005).  

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1068-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.