CD86, also known as the B-lymphocyte activation antigen B7-2, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily.  Like other B7 family members, CD86 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD86 is constitutively expressed on interdigitating dendritic cells, Langerhans cells, peripheral blood dendritic cells, memory B cells, and germinal center B cells.  CD86 provides a co-stimulatory signal necessary for T cell activation and survival. It exists predominantly as a monomer on cell surfaces and interacts with two receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD86 works in tandem with CD80 (also known as B7-1) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL.  The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD86 promotes APC (antigen presenting cell) diversity, function and survival. CD80 and CD86 may act as a receptor for adenovirus subgroup B. CD86 plays an important role in chronic hemodialysis, allergic pulmonary inflammation, arthritis, and antiviral responses, and is thus regarded as a promising target for autoimmune diseases and cancer.  

CD86, also known as the B-lymphocyte activation antigen B7-2, is a single-pass type I transmemebrane glycoprotein that belongs to the B7 family of the Ig superfamily.  Like other B7 family members, CD86 contains 1 Ig-like C2-type domain and 1 Ig-like V-type domain in the extracellular region. Among the B7 family members, they share about 20-25% amino acid identity. CD86 is constitutively expressed on interdigitating dendritic cells, Langerhans cells, peripheral blood dendritic cells, memory B cells, and germinal center B cells.  CD86 provides a co-stimulatory signal necessary for T cell activation and survival. It exists predominantly as a monomer on cell surfaces and interacts with two receptors on the T cell surface: CD28 and CTLA-4 (also known as CD152). CD86 works in tandem with CD80 (also known as B7-1) to prime T cells. CD80 and CD86, together with their receptors CD28 and CTLA4, constitute one of the dominant co-stimulatory pathways that regulate T and B cell responses, tolerance and the generation of CTL.  The binding of CD80:CD86 to its receptor CD28 induces T-cell proliferation and cytokine production. CTLA4 binds to CD80 and CD86 with a 20-100 fold higher affinity than CD28 and is involved in the downregulation of the immune response. CD86 promotes APC (antigen presenting cell) diversity, function and survival. CD80 and CD86 may act as a receptor for adenovirus subgroup B. CD86 plays an important role in chronic hemodialysis, allergic pulmonary inflammation, arthritis, and antiviral responses, and is thus regarded as a promising target for autoimmune diseases and cancer.  

 

Product Details

 

Gene Symbol: CD86; B7-2; B7.2; B70; BU63; FUN-1; CD28LG2; LAB72

 

NCBI Gene ID: 942

 

Uniprot Entry: P42081

 

Construct Details: The recombinant human CD86 ECD protein is expressed as a 235 amino acid protein consisting of Ala24 - Pro247 region of CD86 (UniProt accession #P42081) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.

 

Source:  Human cells stably expressing CD86 ECD and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLR

LHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKM

SVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPP

PDHIPSTGHHHHHHHH

 

M.W.:  Calculated molecular mass 26.9 kDa; estimated by SDS-PAGE under reducing condition 50-60 kDa probably due to glycosylation

 

Calculated PI: 5.88

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm): 23170

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free & preservative free).  The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity:  Binds human CD28 and induces IL-2 secretion by Jurkat human acute T cell leukemia cells

 

  

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nature 366:76 (1993).  

2. Science 262:905 (1993)  

3. J. Exp. Med. 178:2185 (1993).  

4. Cell 80:707 (1995).  

5. Annu. Rev. Immunol. 23:515 (2005).  

 

 

 

 

 FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0718B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.