Axl, also known as Ufo and Ark, is a single-pass type I transmembrane glycoprotein in the TAM receptor tyrosine kinase (RTK) family. Like other family members Tyro3 and Mer, Axl contains two immunoglobulin­like (Ig) domains and two fibronectin type III domains in the extracellular region and a cytoplasmic tyrosine kinase domain. The TAM receptors are involved in regulation of immune response, cell survival and migration as well as tumorigenesis and metastasis. Axl binds to its ligand Gas6 (growth arrest specific protein 6), which triggers tyrosine auto-phosphorylation and activation of Axl. Axl induces a wide range of activities including platelet aggregation and thrombus formation, macrophage and dendritic cell phagocytosis, NK cell development, and angiogenesis. Axl is upregulated in various disease states, such as in multiple sclerosis (MS) lesions. Axl contributes to vascular remodeling and inflammatory cell infiltration. Axl acts as a cellular entry receptor for Gas6­opsonized lentiviruses. Axl also contributes to tumor cell survival, migration, invasion, metastasis and chemosensitivity. Axl is highly expressed in solid cancers and mediates multiple oncogenic phenotypes. Axl expression correlates with poor prognosis in several cancers. A soluble form of the Axl ectodomain, which is shed by proteolytic cleavage, retains the ability to bind Gas6 and blocks its signaling, showing the therapeutic potential in the inhibition of metastatic tumor progression.

Axl, also known as Ufo and Ark, is a single-pass type I transmembrane glycoprotein in the TAM receptor tyrosine kinase (RTK) family. Like other family members Tyro3 and Mer, Axl contains two immunoglobulin­like (Ig) domains and two fibronectin type III domains in the extracellular region and a cytoplasmic tyrosine kinase domain. The TAM receptors are involved in regulation of immune response, cell survival and migration as well as tumorigenesis and metastasis. Axl binds to its ligand Gas6 (growth arrest specific protein 6), which triggers tyrosine auto-phosphorylation and activation of Axl. Axl induces a wide range of activities including platelet aggregation and thrombus formation, macrophage and dendritic cell phagocytosis, NK cell development, and angiogenesis. Axl is upregulated in various disease states, such as in multiple sclerosis (MS) lesions. Axl contributes to vascular remodeling and inflammatory cell infiltration. Axl acts as a cellular entry receptor for Gas6­opsonized lentiviruses. Axl also contributes to tumor cell survival, migration, invasion, metastasis and chemosensitivity. Axl is highly expressed in solid cancers and mediates multiple oncogenic phenotypes. Axl expression correlates with poor prognosis in several cancers. A soluble form of the Axl ectodomain, which is shed by proteolytic cleavage, retains the ability to bind Gas6 and blocks its signaling, showing the therapeutic potential in the inhibition of metastatic tumor progression.

 

Product Details

 

Gene Symbol: AXL; UFO; JTK11

 

NCBI Gene ID: 558

 

Uniprot Entry: P30530

 

Construct Details: The recombinant human AXL-Fc fusion is expressed as a 650 amino acid protein consisting of Ala26 - Ser447 region of AXL and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

 

Source:  Human cells stably expressing AXL-Fc and growing in chemical-defined media with no animal components or antibiotics.

 

Deduced Amino Acid Sequence:

APRGTQAEESPFVGNPGNITGARGLTGTLRCQLQVQGEPPEVHWLRDGQILELADSTQTQ

VPLGEDEQDDWIVVSQLRITSLQLSDTGQYQCLVFLGHQTFVSQPGYVGLEGLPYFLEEP

EDRTVAANTPFNLSCQAQGPPEPVDLLWLQDAVPLATAPGHGPQRSLHVPGLNKTSSFSC

EAHNAKGVTTSRTATITVLPQQPRNLHLVSRQPTELEVAWTPGLSGIYPLTHCTLQAVLS

DDGMGIQAGEPDPPEEPLTSQASVPPHQLRLGSLHPHTPYHIRVACTSSQGPSSWTHWLP

VETPEGVPLGPPENISATRNGSQAFVHWQEPRAPLQGTLLGYRLAYQGQDTPEVLMDIGL

RQEVTLELQGDGSVSNLTVCVAAYTAAGDGPWSLPVPLEAWRPGQAQPVHQLVKEPSTPA

FSSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNW

YVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTIS

KAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPV

LDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 71.1; Estimated by SDS-PAGE under reducing condition (kDa): 80-90

 

Calculated PI: 5.35

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm): 97580

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Interacts with human Gas6 and inhibits Gas6/AXLmediated signaling activity.

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Mol. Cell. Biol. 11:5016 (1991).  

2. J. Biol. Chem. 270:551 (1995).  

3. Nature 373:623 (1995).

4. Cancer Res. 65:9294 (2005).  

5. Cancer Res. 70:7570 (2010).

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1057-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.