
CD34 is a singlepass, type I transmembrane protein belonging to the CD34 family that includes Podocalyxin, and Endoglycan. CD34 is a well-known hematopoietic progenitor cell antigen. It is a sialomucinlike molecule that is heavily glycosylated with 9 potential N-linked glycosylation sites in the extracellular domain. In the cytoplasmic region, CD34 contains serine residues that can be phosphorylated by PKC (protein kinase C), resulting in the recruitment of the hematopoietic adapter proteins and the activation of CD34 signaling pathways. CD34 is expressed on primitive hematopoietic stem cells and down-regulated as they differentiate into mature cells. The precise function of CD34 remains unclear. The pattern of CD34 expression suggests that it plays an important role in hematopoiesis. CD34 is found on multipotent precursors, bone marrow stromal cells, embryonic fibroblasts, vascular endothelia, mesenchymal stem cells, and some tumor cell lines. CD34 is involved in the adhesion of stem cells to the bone marrow extracellular matrix or to stromal cells. It can act as a scaffold for the attachment of lineage specific glycans, allowing stem cells to bind to lectins expressed by stromal cells or other marrow components. CD34 is overexpressed in many types of tumors and implicated in leukemogenesis.
Gene Symbol: CD34
NCBI Gene ID: 947
Uniprot Entry: P28906
Construct Details: The recombinant human CD34 ECD protein is expressed as a 280-amino acid protein consisting of Ser32 - Thr290 region of (UniProt accession #P28906) and a C-terminal His-tag. It contains 9 potential N-linked glycosylation sites.
Source: Human cells stably expressing human CD34 ECD and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQ
SQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICL
EQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLG
ILDFTEQDVASHQSYSQKTSTTENLYFQGSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 30; Estimated by SDS-PAGE under reducing condition (kDa): 75-90 suggesting that the protein may be heavily glycosylated
Calculated PI: 6.16
Calculated extinction coefficients (M-1 cm-1, at 280nm): 7825
Purity: >92% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Interacts with L-selectin and supports the adhesion of the human umbilical vein endothelial cell line (HUVEC). Binds anti-CD34 monoclonal antibodies, human IgG1 (SKU#MAB0820) and rabbit IgG (SKU#MAB1713) by ELISA with this immobilized protein.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Leukemia 2:793-803(1988).
2. J. Biol. Chem. 265:11056-61 (1990).
3. J. Immunol. 148:267-271(1992)
4. Blood 80:3051-59 (1992).
5. Blood 95:756-768 (2000).
Product datasheet (pdf) can be downloaded here: FCL1678-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services