PD-L1 (programmed cell death 1 ligand 1) or CD274 is a 290-amino acid single pass type I transmembrane protein of the Ig (immunoglobulin) superfamily. It contains one Ig V-like and one Ig C-like domains in the extracellular region, and a 30-amino acid cytoplasmic tail. It was originally cloned as a homolog of B7 (termed B7-H1). It is 20% and 15% identical to B7-1 (CD80) and B7-2 (CD86), respectively. It was also cloned as a ligand (termed PDCD1L1 or PD-L1) that binds to PD-1 (CD279) and B7-1 (CD80), but not to other B7 family members, such as CTLA4 (CD152), CD28, or ICOS (CD278). PD-L1 or CD274 is involved in the T cell costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNγ. Interaction with PD-1, which has a cytoplasmic immunoreceptor tyrosine-based inhibitory motif (ITIM), inhibits T-cell proliferation and cytokine production. PD-L1 is up-regulated on T- and B-cells, dendritic cells, keratinocytes and monocytes after LPS and IFNγ activation or by surface Ig cross-linking. It is expressed in many types of freshly isolated human cancers but not in most normal tissues. Blockade of PD-L1 upregulates IL12 expression and enhances antitumor immunity in mice bearing ovarian tumors. Therefore, PD-L1 has been proposed as a target for cancer immunotherapy through pre-activated T cells that could be enhanced by blockade of PD-L1-induced inhibitory signaling.
Gene Symbol: PD-L1; CD274; B7-H1; B7H1; PDL1; PDCD1L1; PDCD1LG1
NCBI Gene ID: 29126
Uniprot Entry: Q9NZQ7
Construct Details: The recombinant human CD274-Fc fusion is expressed as a 448 amino acid protein consisting of Phe19 - Arg238 region of CD274 (UniProt accession #Q9NZQ7) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions (see the gel image above).
Source: Human cells stably expressing PD-L1-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLK
DQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGY
PKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPL
AHPPNERSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVE
VHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPS
REEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSC
SVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass 50.7 kDa; estimated by SDS-PAGE under reducing condition ~ 60 kDa suggesting that the protein is highly glycosylated
Calculated PI: 6.27
Calculated Extinction Coefficients (M-1 cm-1, at 280nm): 61,935
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds to its receptor PD-1 (SKU#: FCL0763), CD80 (SKU#FCL0723) and anti-PD-L1 monoclonal antibody (SKU#: MAB0199, MAB0784, MAB0781) in a functional ELISA (see Technical Data) . Blocks PD-L1’s binding to its receptor and mediated signaling activity.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Technical Data 1: Anti-m,hPD-L1 Antibody Binding Affinity Determination by ELISA
Recombinant human PD-L1-Fc (hPD-L1, SKU#FCL0781), mouse PD-L1-Fc (mPD-L1, SKU#FCL1846), human PD-L2-Fc (hPD-L2, SKU#FCL0783), and mouse PD-L2-Fc (mPD-L2, SKU#FCL1818) proteins was immobilized at 100 ng/well on a 96-well NuncMaxisorp plate for ELISA with serially diluted, biotinylated anti-PD-L1 monoclonal antibody, human IgG1(SKU#MAB0199B). PD-L2 proteins were used as a control to demonstrate the specificity of PD-L1 binding under the experimental conditions. As shown in the figure below, anti-PD-L1 mAb binds specifically to human and mouse PD-L1-Fc (but not to PD-L2-Fc) equally well with an apparent KD for human PD-L1 of 38.1 ± 2.4 pM and an apparent KD for mouse PD-L1 of 38.6± 2.5 pM.
Technical Data 2: Interactions with Human PD-1 and CD80 by ELISA
Recombinant human PD-L1-Fc (SKU#FCL0781) was immobilized at 100 ng/well on a 96-well NuncMaxisorp plate for a functional ELISA with serially diluted, biotinylated human PD-1-Fc (PD-1-Fc-Biot, SKU#FCL0763B), biotinylated human CD80-Fc (CD80-Fc-Biot, SKU#FCL0723B), and biotinylated Fc alone (control Fc-Biot, SKU#FCL00029B). Fc protein alone was used as a negative control to demonstrate the specificity of PD-1:PD-L1 and CD80:PD-L1 interactions under the experimental conditions. The binding curves were fit and apparent KDwas calculated for PD-1: PD-L1 binding to be 365 ± 38 ng/ml with a linear binding range between 100 and 1500 ng/ml, and apparent KD for CD80:PD-L1 binding to be 831 ± 101 ng/ml with a linear binding range between 250 and 4000 ng/ml.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Nat. Med. 5:1365-1369, 1999
2. J. Exp. Med. 192:1027-1034, 2000
3. Nature Med. 8: 793-800, 2002
4. Nature Med. 9: 562-567, 2003
Product datasheet (pdf) can be downloaded here: FCL0781-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services