Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human MSLN/Mesothelin protein, biotinylated, recombinant

Product ID: MSLN-Biot (SKU#: FCL1589B)

For Bulk Order: Call for price

Price:
$497.00
Size

Description

Mesothelin (MSLN) is a glycosylphosphatidylinositol (GPI)-anchored glycoprotein that is expressed on mesothelial cells in the pleura, pericardium and peritoneum.  It is overexpressed in mesotheliomas, ovarian and pancreatic cancers as well as in specific squamous cell carcinomas. The MSLN gene encodes a precursor protein that is cleaved into two products, megakaryocyte-potentiating factor (MPF) and MSLN. MPF is secreted and functions as a cytokine that can stimulate colony formation in bone marrow megakaryocytes. The cleaved form of MSLN remains GPI-anchored on cell-surface and may function as a cell adhesion molecule. Alternative splicing results in multiple transcript variants. Two variant forms exist; variant 1 has an eight amino acid insertion and is rarely expressed, while variant 2 is a truncated form found in cancers but rarely detected in normal individuals. MSLN interacts with CA125/MUC16 and potentiates megakaryocyte colony formation in vitro. MSLN is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment. 

 

Mesothelin (MSLN) is a glycosylphosphatidylinositol (GPI)-anchored glycoprotein that is expressed on mesothelial cells in the pleura, pericardium and peritoneum.  It is overexpressed in mesotheliomas, ovarian and pancreatic cancers as well as in specific squamous cell carcinomas. The MSLN gene encodes a precursor protein that is cleaved into two products, megakaryocyte-potentiating factor (MPF) and MSLN. MPF is secreted and functions as a cytokine that can stimulate colony formation in bone marrow megakaryocytes. The cleaved form of MSLN remains GPI-anchored on cell-surface and may function as a cell adhesion molecule. Alternative splicing results in multiple transcript variants. Two variant forms exist; variant 1 has an eight amino acid insertion and is rarely expressed, while variant 2 is a truncated form found in cancers but rarely detected in normal individuals. MSLN interacts with CA125/MUC16 and potentiates megakaryocyte colony formation in vitro. MSLN is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment. 

 

Product Details

 

Gene Symbol: MSLN; MPF; SMRP; CAK1

 

NCBI Gene ID: 10232

 

Uniprot Entry: Q13421

 

Construct Details: The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 -  Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites.

 

Source: Human cells stably expressing human MSLN and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYL

FLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPS

SIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLT

VAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSTTENLYFQGSTGHHHHHHHH

 

M.W.: Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50

 

Calculated PI: 5.62

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  38640

 

Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 (SKU#: MAB1458) with high affinity KD < 5 nM as measured by ELISA.

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Biol. Chem. 269:805-808 (1994)

2. J. Biol. Chem. 270:21984-21990 (1995)

3. Clin. Cancer Res. 12:4225-4231 (2006)

4. Proc. Natl. Acad. Sci. 96:11531-11536 (1999)

 



 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1589B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class GPI-anchored Protein
Gene Synonym MSLN; MPF; SMRP; CAK1
Gene Family Mesothelin Family
Research Area Cancer
"A" - "Z" List
M
Pathway/Disease Cell Adhesion
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services