Mesothelin (MSLN) is a glycosylphosphatidylinositol (GPI)-anchored glycoprotein that is expressed on mesothelial cells in the pleura, pericardium and peritoneum. It is overexpressed in mesotheliomas, ovarian and pancreatic cancers as well as in specific squamous cell carcinomas. The MSLN gene encodes a precursor protein that is cleaved into two products, megakaryocyte-potentiating factor (MPF) and MSLN. MPF is secreted and functions as a cytokine that can stimulate colony formation in bone marrow megakaryocytes. The cleaved form of MSLN remains GPI-anchored on cell-surface and may function as a cell adhesion molecule. Alternative splicing results in multiple transcript variants. Two variant forms exist; variant 1 has an eight amino acid insertion and is rarely expressed, while variant 2 is a truncated form found in cancers but rarely detected in normal individuals. MSLN interacts with CA125/MUC16 and potentiates megakaryocyte colony formation in vitro. MSLN is secreted by several mesothelioma cell lines and is frequently elevated in the blood of patients with mesothelioma. Measurement of this protein may be useful in following the response of mesothelioma to treatment.
Gene Symbol: MSLN; MPF; SMRP; CAK1
NCBI Gene ID: 10232
Uniprot Entry: Q13421
Construct Details: The recombinant human MSLN is expressed as a 317-amino acid protein consisting of Glu296 - Ser592 region of MSLN (UniProt accession #Q13421, isoform 2) and a C-terminal His-tag. It contains 4 potential N-linked glycosylation sites.
Source: Human cells stably expressing human MSLN and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
EVEKTACPSGKKAREIDESLIFYKKWELEACVDAALLATQMDRVNAIPFTYEQLDVLKHKLDELYPQGYPESVIQHLGYL
FLKMSPEDIRKWNVTSLETLKALLEVNKGHEMSPQVATLIDRFVKGRGQLDKDTLDTLTAFYPGYLCSLSPEELSSVPPS
SIWAVRPQDLDTCDPRQLDVLYPKARLAFQNMNGSEYFVKIQSFLGGAPTEDLKALSQQNVSMDLATFMKLRTDAVLPLT
VAEVQKLLGPHVEGLKAEERHRPVRDWILRQRQDDLDTLGLGLQGGIPNGYLVLDLSTTENLYFQGSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 35.9; Estimated by SDS-PAGE under reducing condition (kDa): 48-50
Calculated PI: 5.62
Calculated extinction coefficients (M-1 cm-1, at 280nm): 38640
Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds to CA125/MUC16 and anti-MSLN monoclonal antibody, human IgG1 (SKU#: MAB1458) with high affinity KD < 5 nM as measured by ELISA.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. J. Biol. Chem. 269:805-808 (1994)
2. J. Biol. Chem. 270:21984-21990 (1995)
3. Clin. Cancer Res. 12:4225-4231 (2006)
4. Proc. Natl. Acad. Sci. 96:11531-11536 (1999)
Product datasheet (pdf) can be downloaded here: FCL1589B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services