
IL1RL1 (interleukin 1 receptor-like 1), also known as ST2, DER4, IL1R4 and IL33R, is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin 1 receptor (IL1R) family. The IL1R family comprises at least 10 members, which typically contain 3 immunoglobulin (Ig)-like domains in the extracellular region. Most members also have an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RL1 can be induced by proinflammatory stimuli, and is involved in the function of helper T (Th) cells. IL1RL1, IL1R1, IL1R2 and IL1RL2 form a cytokine receptor gene cluster in chromosome 2q12. IL1RL1 is expressed on mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It was identified as the receptor for IL33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL1RL1 may promote mast cell and Th2 dependent inflammation, enhance antigen-induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. IL1RL1 has been used as a marker for the diagnosis and prognosis of cardiovascular diseases. Mutations in the IL1RL1 gene are associated with blood eosinophil counts and with asthma. A soluble IL1RL1 isoform is released by activated Th2 cells and is elevated in the serum in allergic asthma. Soluble IL1RL1 may function as a decoy receptor that blocks IL33/IL1RL1-mediated signaling activity.
Gene Symbol: IL1RL1; ST2; IL1R4; T1; DER4; ST2L; ST2V; FIT-1; IL33R
NCBI Gene ID: 9173
Uniprot Entry: Q01638
Construct Details: The recombinant human IL1RL1 ECD is expressed as a 320 amino acid protein consisting of Lys19 Ser328 region of IL1RL1/ST2 (UniProt accession #Q01638) and a C-terminal His-tag.
Source: Human cells stably expressing human IL1RL1 ECD and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFL
PAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIY
CPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENG
ANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFL
AAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDC
LALNLHGLRRHTVRLSRKNPIDHHSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 36.3; Estimated by SDS-PAGE under reducing condition (kDa): 60-70 (probably due to glycosylation).
Calculated PI: 8.28
Calculated extinction coefficients (M-1 cm-1, at 280nm): 48985
Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above)
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Immobilized IL1RL1 binds human IL33 in a functional ELISA. Blocks IL33-dependent signaling activity in helper T cells.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Genomics 67: 284 (2000).
2. Circulation 106:2961 (2002).
3. Nat. Immunol. 5:373 (2004).
4. Proc. Natl. Acad. Sci. 105:2723 (2008).
5. J. Exp. Med. 205:339 (2008).
Product datasheet (pdf) can be downloaded here: FCL1240B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services