Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human IL1RAP Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Product ID: IL1RAP-Fc-Biot (SKU#: FCL1288B)

For Bulk Order: Call for price

Price:
$648.00
Size

Description

IL1RAP (interleukin-1 receptor accessory protein), also known as IL1R3 (interleukin-1 receptor 3), is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin-1 receptor (IL1R) family. Like other family members, IL1RAP contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RAP is identified as a co-receptor for a high-affinity IL-1 receptor type I (IL1R1) complex that mediates IL1-dependent activation of NF-κB, MAPK and other signaling pathways. IL1RAP is required for transducing the signaling events on the plasma membrane level to downstream activation of IL1-responsive genes.  IL1 are pleiotropic cytokines that induce synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress. Alternative splicing of the IL1RAP gene results in 2 transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. The soluble form of IL1RAP contributes to the antagonism of IL-1 action.  When present with soluble IL1R2, soluble IL1RAP increases the IL­1 binding affinity y of IL1R2 more than 100­fold.  In addition, ILRAP interacts with ST2 on mast cells and Th2 T lymphocytes to create a functional receptor complex for transducing IL33-dependent signaling activity.

 

IL1RAP (interleukin-1 receptor accessory protein), also known as IL1R3 (interleukin-1 receptor 3), is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin-1 receptor (IL1R) family. Like other family members, IL1RAP contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RAP is identified as a co-receptor for a high-affinity IL-1 receptor type I (IL1R1) complex that mediates IL1-dependent activation of NF-κB, MAPK and other signaling pathways. IL1RAP is required for transducing the signaling events on the plasma membrane level to downstream activation of IL1-responsive genes.  IL1 are pleiotropic cytokines that induce synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress. Alternative splicing of the IL1RAP gene results in 2 transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. The soluble form of IL1RAP contributes to the antagonism of IL-1 action.  When present with soluble IL1R2, soluble IL1RAP increases the IL­1 binding affinity y of IL1R2 more than 100­fold.  In addition, ILRAP interacts with ST2 on mast cells and Th2 T lymphocytes to create a functional receptor complex for transducing IL33-dependent signaling activity.

 

Product Details

 

Gene Symbol: IL1RAP; IL-1RAP; IL1R3; IL-1R3; IL-1R-3; C3orf13; IL-1RAcP

 

NCBI Gene ID: 3556

 

Uniprot Entry: Q9NPH3

 

Construct Details: The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 - ­Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human IL1RAP-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK

EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP

SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP

PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL

SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP

ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL

TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE

WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).

 

Calculated PI: 6.93

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  98750

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 - 2.5 µg/ml.

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Proc. Natl. Acad. Sci. 94:12829-32 (1997).

2. J.Biol. Chem. 272: 7727-31 (1997).

3. J. Immunol. 161:6871 (1998).  

4. J. Immunol. 160:3170 (1998).

5. Immunity, 18: 87-96 (2003).

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1288B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-Pass Type I Transmembrane
Gene Synonym IL-1RAP; IL1R3; IL-1R3; IL-1R-3; C3orf13; IL-1RAcP
Gene Family Ig Superfamily; IL1 Receptor Family
Research Area Immunology
"A" - "Z" List
I
Pathway/Disease IL1R/TLR Signaling Pathway
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services