
IL1RAP (interleukin-1 receptor accessory protein), also known as IL1R3 (interleukin-1 receptor 3), is a single-pass, type I transmembrane glycoprotein that belongs to the interleukin-1 receptor (IL1R) family. Like other family members, IL1RAP contain 3 immunoglobulin (Ig)-like domains in the extracellular region and an intracellular TIR (Toll-like receptor/IL-1 receptor) signaling domain that is also conserved in the Toll-like receptor family. IL1RAP is identified as a co-receptor for a high-affinity IL-1 receptor type I (IL1R1) complex that mediates IL1-dependent activation of NF-κB, MAPK and other signaling pathways. IL1RAP is required for transducing the signaling events on the plasma membrane level to downstream activation of IL1-responsive genes. IL1 are pleiotropic cytokines that induce synthesis of acute phase and proinflammatory proteins during infection, tissue damage, or stress. Alternative splicing of the IL1RAP gene results in 2 transcript variants encoding two different isoforms, one membrane-bound and one soluble. The ratio of soluble to membrane-bound forms increases during acute-phase induction or stress. The soluble form of IL1RAP contributes to the antagonism of IL-1 action. When present with soluble IL1R2, soluble IL1RAP increases the IL1 binding affinity y of IL1R2 more than 100fold. In addition, ILRAP interacts with ST2 on mast cells and Th2 T lymphocytes to create a functional receptor complex for transducing IL33-dependent signaling activity.
Gene Symbol: IL1RAP; IL-1RAP; IL1R3; IL-1R3; IL-1R-3; C3orf13; IL-1RAcP
NCBI Gene ID: 3556
Uniprot Entry: Q9NPH3
Construct Details: The recombinant human IL1RAP ECD is expressed as a 585 amino acid protein consisting of Ser21 - Thr367 region of IL1RAP (UniProt accession #Q9NPH3) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells stably expressing human IL1RAP-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
SERCDDWGLDTMRQIQVFEDEPARIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRISK
EKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDSCFNSPMKLPVHKLYIEYGIQRITCPNVDGYFP
SSVKPTITWYMGCYKIQNFNNVIPEGMNLSFLIALISNNGNYTCVVTYPENGRTFHLTRTLTVKVVGSPKNAVP
PVIHSPNDHVVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGKKPDDITIDVTINESISHSRTEDETRTQIL
SIKKVTSEDLKRSYVCHARSAKGEVAKAAKVKQKVPAPRYTVELACGFGATSTTENLYFQGSTGTHTCPPCPAP
ELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVL
TVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVE
WESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 66.5; Estimated by SDS-PAGE under reducing condition (kDa): 75-80 (probably due to glycosylation).
Calculated PI: 6.93
Calculated extinction coefficients (M-1 cm-1, at 280nm): 98750
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds human IL1 as well as IL1R1 and IL1R2, and blocks IL1-dependent signaling activity with a typical ED50 of 0.5 - 2.5 µg/ml.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Proc. Natl. Acad. Sci. 94:12829-32 (1997).
2. J.Biol. Chem. 272: 7727-31 (1997).
3. J. Immunol. 161:6871 (1998).
4. J. Immunol. 160:3170 (1998).
5. Immunity, 18: 87-96 (2003).
Product datasheet (pdf) can be downloaded here: FCL1288B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services