Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human HER2 protein (extracellular domain), Fc-fusion, biotinylated, recombinant

Product ID: HER2-Fc-Biot (SKU#: FCL0088B)

For Bulk Order: Call for price

Price:
$648.00
Size

Description

HER2 is also known as receptor tyrosine-protein kinase erbB-2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2),  metastatic lymph node gene 19 protein, proto-oncogene Neu, p185erbB2. It is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK).  Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4).  They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity.  EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.  HER2 has no ligand binding domain of its own and therefore cannot bind growth factors.  However, it does bind tightly to other ligand-bound EGFR family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways.  Amplification or overexpression of HER2 has been reported in multiple cancers, including breast and ovarian tumors.  HER2 is the target of several anti-cancer therapeutics.

 

HER2 is also known as receptor tyrosine-protein kinase erbB-2 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 2),  metastatic lymph node gene 19 protein, proto-oncogene Neu, p185erbB2. It is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK).  Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4).  They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity.  EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation. Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.  HER2 has no ligand binding domain of its own and therefore cannot bind growth factors.  However, it does bind tightly to other ligand-bound EGFR family members to form a heterodimer, stabilizing ligand binding and enhancing kinase-mediated activation of downstream signalling pathways.  Amplification or overexpression of HER2 has been reported in multiple cancers, including breast and ovarian tumors.  HER2 is the target of several anti-cancer therapeutics.

 

Product Details

 

Gene Symbol: HER2; ERBB2; CD340; NGL; TKR1; MLN19; HER-2/neu

 

NCBI Gene ID: 2064

 

Uniprot Entry: P04626

 

Construct Details: Expressed as a 866 amino acid protein consisting of Thr23-Thr652 region of HER2 and a C-terminal Fc fusion from human IgG1, which exists as a a dimmer under non-reducing condition (see the gel image, labeled as DTT "-").

 

Source:  Human cells stably expressing HER2-Fc fusion and growing in chemical-defined media with no animal components or antibiotics.

 

Deduced Amino Acid Sequence:

TQVCTGTDMKLRLPASPETHLDMLRHLYQGCQVVQGNLELTYLPTNASLSFLQDIQEVQGYVLIAHNQVRQVPLQRLRIVR

GTQLFEDNYALAVLDNGDPLNNTTPVTGASPGGLRELQLRSLTEILKGGVLIQRNPQLCYQDTILWKDIFHKNNQLALTLI

DTNRSRACHPCSPMCKGSRCWGESSEDCQSLTRTVCAGGCARCKGPLPTDCCHEQCAAGCTGPKHSDCLACLHFNHSGICE

LHCPALVTYNTDTFESMPNPEGRYTFGASCVTACPYNYLSTDVGSCTLVCPLHNQEVTAEDGTQRCEKCSKPCARVCYGLG

MEHLREVRAVTSANIQEFAGCKKIFGSLAFLPESFDGDPASNTAPLQPEQLQVFETLEEITGYLYISAWPDSLPDLSVFQN

LQVIRGRILHNGAYSLTLQGLGISWLGLRSLRELGSGLALIHHNTHLCFVHTVPWDQLFRNPHQALLHTANRPEDECVGEG

LACHQLCARGHCWGPGPTQCVNCSQFLRGQECVEECRVLQGLPREYVNARHCLPCHPECQPQNGSVTCFGPEADQCVACAH

YKDPPFCVARCPSGVKPDLSYMPIWKFPDEEGACQPCPINCTHSCVDLDDKGCPAEQRASPLTSTGDEPKSCDKTHTCPPC

PAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH

QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNY

KTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK


M.W.: Calculated molecular mass (kDa): 95.8 ; Estimated by SDS-PAGE under reducing condition (kDa): 100

 

Calculated PI: 5.97

 

Calculated Extinction Coefficients (M-1 cm-1, at 280nm):  101250

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: The recombinant protein binds anti-HER2 mAbs (SKU#MAB0061, #MAB0203, #MAB0334) and therapeutic antibodies such as Herceptin with high affinity.  It blocks anti-HER2 mAb-mediated inhibition of SKBR‑3 breast cancer cell proliferation (ED50 ~40 ng/ml).

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1.  Science 230: 1132–9, 1985
2.  Nature 319:230-234, 1986
3.  Science 229:974-976, 1985
4.  Cancer Cell 5:317-328, 2004

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0088B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class Receptor Tyrosine Kinase (RTK)
Gene Family Tyrosine Protein Kinase Family; EGF Receptor (EGFR) Subfamily
Gene Synonym HER2; ERBB2; CD340; NGL; TKR1; MLN19; HER-2/neu
Research Area Cancer
"A" - "Z" List
H
CD Antigen CD340
Pathway/Disease EGF/PDGF Signaling Pathway
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services