Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human FGFR1 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Product ID: FGFR1-Fc-Biot (SKU#: FCL0650B)

For Bulk Order: Call for price

Price:
$648.00
Size

Description

FGFR1 (fibroblast growth factor receptor 1), also known as FLT-2 and CD331, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family.  There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR1 is the receptor for FGF basic and also interacts with GRB14, SHB, FRS2. The extracellular region of FGFR1 interacts with FGFs, setting in motion a cascade of downstream signals, ultimately leading to mitogenesis and differentiation. FGFR1 plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGFR1 are the cause of several diseases, such as Kallmann syndrome type 2 (KAL2), osteoglophonic dysplasia (OGD), and Pfeiffer syndrome (PF). Chromosomal aberrations involving FGFR1 are associated with stem cell leukemia lymphoma syndrome (SCLL) and stem cell myeloproliferative disorder (MPD).

 

FGFR1 (fibroblast growth factor receptor 1), also known as FLT-2 and CD331, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family.  There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR1 is the receptor for FGF basic and also interacts with GRB14, SHB, FRS2. The extracellular region of FGFR1 interacts with FGFs, setting in motion a cascade of downstream signals, ultimately leading to mitogenesis and differentiation. FGFR1 plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGFR1 are the cause of several diseases, such as Kallmann syndrome type 2 (KAL2), osteoglophonic dysplasia (OGD), and Pfeiffer syndrome (PF). Chromosomal aberrations involving FGFR1 are associated with stem cell leukemia lymphoma syndrome (SCLL) and stem cell myeloproliferative disorder (MPD).

 

Product Details

 

Gene Symbol: FGFR1; CD331; FGFR-1; CEK; FLG; HH2; OGD; c-Fgr; FLT2; KAL2; BFGFR; FGFBR; FLT-2; HBGFR; N-SAM; HRTFDS; bFGF-R-1

 

NCBI Gene ID: 2260

 

Uniprot Entry: P11362

 

Construct Details: The recombinant human FGFR1-Fc fusion protein is expressed as a 492 amino acid protein consisting of Arg22 - Glu285 region of FGFR1 (Uniprot accession #P11362 - isoform 15) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

 

Source: Human cells stably expressing FGFR1-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVK

FKCPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGS

INHTYQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIG

PDNLPYVQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEE

RPAVMTSPLYLESTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHED

PEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIE

KTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPP

VLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 55.0; Estimated by SDS-PAGE under reducing condition (kDa): 70-80

 

Calculated PI: 5.85

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  78435

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+" and "M")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED50 of 0.02 - 0.15 μg/mL

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Biol. Chem. 271: 1726-1731 (1996).

2. Biochem. Cell Biol. 75:669 (1997).  

3. Proc. Natl. Acad. Sci. 97: 49-54 (2000).

4. Nature. 407: 1029-1034 (2000).

5. Nature Genetics. 39: 870-874 (2007).




 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0650B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class Receptor Tyrosine Kinase (RTK)
Gene Synonym FGFR1; CD331; FGFR-1; CEK; FLG; HH2; OGD; c-Fgr; FLT2; KAL2; BFGFR; FGFBR; FLT-2; HBGFR; N-SAM; HRTFDS; bFGF-R-1
Gene Family Tyrosine Protein Kinase Family; FGF Receptor (FGFR) Subfamily
Research Area Development
"A" - "Z" List
F
Pathway/Disease FGF/FGFR Signaling Pathway
Species
Human
CD Antigen CD331

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services