FGFR3 (fibroblast growth factor receptor 3), also known as JTK4 and CD333, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family.   There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR3 is expressed in liver, lung, kidney, testis, ovary and uterus , with highest levels in brain in adults. FGFR3 is a receptor for acidic and basic fibroblast growth factors, and preferentially binds to FGF1.  It plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. FGFR3 regulates both osteogenesis and postnatal bone mineralization by osteoblasts.  Defects in FGFR3 are associated with many diseases, such as achondroplasia (ACH), Crouzon syndrome with acanthosis nigricans (CAN) and thanatophoric dysplasia type 1 (TD1).  A chromosomal aberration involving FGFR3 is also found in multiple myeloma. 

FGFR3 (fibroblast growth factor receptor 3), also known as JTK4 and CD333, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family.   There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)­like domains, an acid­box region, a transmembrane domain and a cytoplasmic tyrosine­kinase domain. FGFR3 is expressed in liver, lung, kidney, testis, ovary and uterus , with highest levels in brain in adults. FGFR3 is a receptor for acidic and basic fibroblast growth factors, and preferentially binds to FGF1.  It plays an essential role in the regulation of chondrocyte differentiation, proliferation and apoptosis, and is required for normal skeleton development. FGFR3 regulates both osteogenesis and postnatal bone mineralization by osteoblasts.  Defects in FGFR3 are associated with many diseases, such as achondroplasia (ACH), Crouzon syndrome with acanthosis nigricans (CAN) and thanatophoric dysplasia type 1 (TD1).  A chromosomal aberration involving FGFR3 is also found in multiple myeloma. 

 

Product Details

 

Gene Symbol: FGFR3; CD333; FGFR-3; ACH; CEK2; JTK4; JTK-4; HSFGFR3EX

 

NCBI Gene ID: 2261

 

Uniprot Entry: P22607

 

Construct Details: The recombinant human FGFR3-Fc fusion protein is expressed as a 581 amino acid protein consisting of Glu23 - Gly375 region of FGFR3 (Uniprot accession #P22607 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

 

Source: Human cells stably expressing FGFR3-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

ESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELSCPPPGGGPMGPTVWVKDGTGLVPSER

VLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCHFSVRVTDAPSSGDDEDGEDEAEDTGVDTGA

PYWTRPERMDKKLLAVPAANTVRFRCPAAGNPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLV

MESVVPSDRGNYTCVVENKFGSIRQTYTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVY

SDAQPHIQWLKHVEVNGSKVGPDGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAG

NSIGFSHHSAWLVVLPAEEELVEADEAGSVYAGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDT

LMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWL

NGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA

VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLS

LSPGK

 

M.W.: Calculated molecular mass (kDa): 63.7; Estimated by SDS-PAGE under reducing condition (kDa): 80-90

 

Calculated PI: 5.57

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  81080

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells with an ED₅₀ of 0.05 - 0.3 μg/ml

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nature 371:252-254 (1994) 

2. Nat. Genet. 9:321-328 (1995) 

3. Nat. Genet. 11:462-464 (1995) 

4. Nat. Genet. 16:260-264 (1997) 

5. Trends Biochem. Sci. 23:59 (1998)

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0860-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.