CD38, also known as ADPribosyl cyclase, is a single-pass type II transmembrane protein. CD38 is expressed in B and T lymphocytes, osteoclasts, and in cardiac, pancreatic, liver and kidney cells. CD38 is a multifunctional ectoenzyme that catalyzes the synthesis and hydrolysis of cyclic ADP-ribose from NAD+ to ADP-ribose. Through its production of cyclic ADPribose, CD38 modulates calcium signaling in many types of cells, including neutrophils and pancreatic β cells. CD38 also functions in cell adhesion signal transduction. CD38 has been used as a prognostic marker in leukemia and a surface marker to identify plasma cells. CD38 also plays a key role in neuropeptide release. It may regulate maternal and social behaviors, thereby contributing to neurodevelopmental disorders. Defects of CD38 are associated with impaired immune responses, metabolic disturbances, and behavioral modifications. CD38 is implicated in human immunodeficiency virus (HIV) infection, leukemias, myelomas, solid tumors, type II diabetes mellitus, and bone metabolism. In addition to immune responses, CD38 may play an equally important role as an intrinsic pulmonary component. CD38 is the main cellular NADase in mammalian tissues to control cellular NAD levels, making CD38 a promising therapeutic target for multiple pathological conditions.
Gene Symbol: CD38; T10; ADPRC1; ADPRC-1
NCBI Gene ID: 952
Uniprot Entry: P28907
Construct Details: The recombinant human CD38-Fc is expressed as a 482-amino acid protein consisting of Arg47 - Ile300 region of CD38 (UniProt accession #P28907) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells stably expressing human CD38-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
RQQWSGPGTTKRFPETVLARCVKYTEIHPEMRHVDCQSVWDAFKGAFISKHPCNITEEDYQPLMKLGTQ
TVPCNKILLWSRIKDLAHQFTQVQRDMFTLEDTLLGYLADDLTWCGEFNTSKINYQSCPDWRKDCSNNP
VSVFWKTVSRRFAEAACDVVHVMLNGSRSKIFDKNSTFGSVEVHNLQPEKVQTLEAWVIHGGREDSRDL
CQDPTIKELESIISKRNIQFSCKNIYRPDKFLQCVKNPEDSSCTSEISTGTHTCPPCPAPELLGGPSVF
LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLH
QDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAV
EWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 54.9; Estimated by SDS-PAGE under reducing condition (kDa): 60-70
Calculated PI: 6.97
Calculated extinction coefficients (M-1 cm-1, at 280nm): 82485
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT: "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Immobilized CD38 binds anti-CD38 monoclonal antibodies, human IgG1 (SKU#MAB1135), mouse IgG2a (SKU#MAB1119) and rabbit IgG (SKU#MAB1017) in a functional ELISA. Converts the enzymatic substrate nicotinamide guanine dinucleotide (NGD+) to cyclic GDP-ribose.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. J. Immunol. 144:2811 (1990).
2. J. Biol. Chem. 270:30045 (1995).
3. Nature Med. 7:1209 (2001).
4. Nature. 446 (7131): 41 (2007).
5. Curr. Mol. Med. 4:249 (2004).
Product datasheet (pdf) can be downloaded here: FCL1017-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services