
CD30/TNFRSF8 is a single-pass type I transmembrane glycoprotein of the TNF receptor superfamily (TNFRSF). The ligand for CD30 is CD30L/CD153, a member of the TNF superfamily (TNFSF8). CD30L-CD30 ligation mediates pleiotropic effects, including cell proliferation, activation, differentiation and apoptosis. CD30 is expressed in activated, but not resting, T and B cells. CD30 can regulate proliferation of lymphocytes and may also play an important role in human immunodeficiency virus (HIV) replication. As a regulator of apoptosis, CD30 protein induces cell death or proliferation, depending on the cell type, and has been shown to limit the proliferative potential of autoreactive CD8 effector T cells and protect the body against autoimmunity. CD30 contributes to thymic negative selection by inducing the apoptotic cell death of CD4+CD8+ T cells. In B cells, CD30 ligation promotes cellular proliferation and antibody production. CD30 is overexpressed in various hematological malignancies, including Reed-Sternberg cells in Hodgkin's disease (HD), anaplastic large cell lymphoma (ALCL) and subsets of Non-Hodgkin's lymphomas (NHLs). CD30 is also found in leukocytes in patients with chronic inflammatory diseases, including lupus erythematosus, asthma, rheumatoid arthritis and atopic dermatitis.
Gene Symbol: CD30; Ki-1; TNFRSF8; D1S166E
NCBI Gene ID: 943
Uniprot Entry: P28908
Construct Details: The recombinant human CD30 ECD is expressed as a 368 amino acid protein consisting of Phe19 - Ser378 region of CD30 (UniProt accession #P28908) and a C-terminal His-tag. It contains 2 potential sites for N-linked glycosylation.
Source: Human cells stably expressing human CD30 ECD and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVT
CSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASP
GVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPS
SDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICA
TSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDS
QASKTLPIPTSAPVALSSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 39.4; Estimated by SDS-PAGE under reducing condition (kDa): 70-80
Calculated PI: 6.13
Calculated extinction coefficients (M-1 cm-1, at 280nm): 25045
Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds to its ligand CD30L in a functional ELISA and anti-CD30 monoclonal antibodies (SKU#MAB1173, #MAB1174, #MAB1176) with high affinity. Blocks CD30 Ligand-induced IL6 secretion by human Hodgkin’s lymphoma cells
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Cell 68:421 (1992).
2. J. Immunol. 156:1387 (1996).
3. Proc. Natl. Acad. Sci. 93 (24): 14053 (1996).
4. J. Biol. Chem. 271 (22): 12852 (1996).
5. Immunology 118:143 (2006).
Product datasheet (pdf) can be downloaded here: FCL0815-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services