TIM­3 (T cell immunoglobulin and mucin domain­3), also known as HAVCR2, is a single-pass type I transmembrane glycoprotein of the TIM family of Ig superfamily.  Like other family members, TIM-3 contains one Ig­like V­type domain and a Ser/Thr­rich mucin stalk domain in the extracellular region. An alternatively spliced isoform is truncated within the mucin­like stalk. TIM-3 is selectively expressed on Th1 (T-helper type 1) cells but not on Th2 cells. Th1 cells produce cytokines (IFN-γ, interleukin-2, TNF-α and lymphotoxin) associated with cell-mediated immune responses against intracellular pathogens, delayed-type hypersensitivity, and induction of organ-specific autoimmunity. TIM­3 is up­regulated on activated myeloid cells and T cells. TIM-3 regulates macrophage activation and inhibits Th1-mediated auto- and allo-immune responses to promote immunological tolerance. It may be also involved in T-cell homing. Galectin­9 has been identified as a ligand for TIM-3.  The binding of Galectin-9 to TM-3 enhances immune tolerance and inhibits anti­tumor immunity. It can alternatively trigger immune stimulatory effects, such as the co-activation of NK cell cytotoxicity. TIM­3 dampens inflammation by enabling the phagocytosis of apoptotic cells and the cross­presentation of apoptotic cell antigens. Dysregulation of the Galectin-9/TIM-3 pathway is implicated in many chronic autoimmune conditions in human, such as multiple sclerosis and systemic lupus erythematosus. 

TIM­3 (T cell immunoglobulin and mucin domain­3), also known as HAVCR2, is a single-pass type I transmembrane glycoprotein of the TIM family of Ig superfamily.  Like other family members, TIM-3 contains one Ig­like V­type domain and a Ser/Thr­rich mucin stalk domain in the extracellular region. An alternatively spliced isoform is truncated within the mucin­like stalk. TIM-3 is selectively expressed on Th1 (T-helper type 1) cells but not on Th2 cells. Th1 cells produce cytokines (IFN-γ, interleukin-2, TNF-α and lymphotoxin) associated with cell-mediated immune responses against intracellular pathogens, delayed-type hypersensitivity, and induction of organ-specific autoimmunity. TIM­3 is up­regulated on activated myeloid cells and T cells. TIM-3 regulates macrophage activation and inhibits Th1-mediated auto- and allo-immune responses to promote immunological tolerance. It may be also involved in T-cell homing. Galectin­9 has been identified as a ligand for TIM-3.  The binding of Galectin-9 to TM-3 enhances immune tolerance and inhibits anti­tumor immunity. It can alternatively trigger immune stimulatory effects, such as the co-activation of NK cell cytotoxicity. TIM­3 dampens inflammation by enabling the phagocytosis of apoptotic cells and the cross­presentation of apoptotic cell antigens. Dysregulation of the Galectin-9/TIM-3 pathway is implicated in many chronic autoimmune conditions in human, such as multiple sclerosis and systemic lupus erythematosus. 

 

Product Details

 

Gene Symbol: TIM-3; TIM3; TIMD3; TIMD-3; KIM-3; HAVCR2; HAVCR-2

 

NCBI Gene ID: 84868

 

Uniprot Entry: Q8TDQ0

 

Construct Details: The recombinant human TIM-3-Fc fusion protein is expressed as a 409 amino acid protein consisting of Ser22 - Gly202 region of TIM-3 (UniProt accession #Q8TDQ0) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

  

Source: Human cells stably expressing human TIM-3-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIE

NVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQ

ISTLANELRDSRLANDLRDSGATIRIGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE

DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP

QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF

SCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 45.6; Estimated by SDS-PAGE under reducing condition (kDa): ~65 (probably due to glycosylation).

 

Calculated PI: 7.04

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  61600

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds its ligand Galectin-9 and blocks Galectin-9/TIM-3 mediated signaling activity.

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Nature 415:536 (2002). 

2. Nat. Immunol. 4:1093 (2003). 

3. Nat. Immunol. 4:1102 (2003).

4. J. Exp. Med. 203:1413 (2006).

5. Science 318:1141 (2007).

 

 

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0858-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.