Leukemia inhibitory factor (LIF) is a member of a cytokine family that includes oncostatin M (OSM), granulocyte colony-stimulating factor (G-CSF), and interleukin 6 (IL-6). It shows a wide spectrum of biologic activities, including the growth promotion and differentiation of different types of cells, bone metabolism, cachexia, neural development, embryogenesis and inflammation. LIF has the capacity to induce differentiation in leukemic cells, embryonic stem cells, hematopoietic and neuronal cells. LIF is also a proinflammatory cytokine and induces the acute phase protein synthesis and affects the cell recruitment into the area of damage or inflammation. LIF has been implicate as an important factor for the development of the early embryo. LIF may also play a role in immune tolerance at the maternal-fetal interface. LIF supports the maintenance of mouse embryonic stem (ES) cell pluripotency and germline competency. LIF binds to the LIF receptor (LIFRα), which forms a heterodimer with a common β-subunit, GP130. This leads to activation and transduction of the JAK/STAT and MAPK signaling cascades. LIF is known as a direct transcriptional target of STAT5: STAT5 binds to LIF promoter and LIF expression is up-regulated after activation of the JAK2/STAT5 pathway.  The LIF expression is significantly increased in patients with chronic myeloproliferative neoplasms. Owning to its pleiotropic functions, LIF has been involved in the pathogenesis of many diseases of various origins.  Human LIF shows 80% sequence identity to mouse LIF.

Leukemia inhibitory factor (LIF) is a member of a cytokine family that includes oncostatin M (OSM), granulocyte colony-stimulating factor (G-CSF), and interleukin 6 (IL-6). It shows a wide spectrum of biologic activities, including the growth promotion and differentiation of different types of cells, bone metabolism, cachexia, neural development, embryogenesis and inflammation. LIF has the capacity to induce differentiation in leukemic cells, embryonic stem cells, hematopoietic and neuronal cells. LIF is also a proinflammatory cytokine and induces the acute phase protein synthesis and affects the cell recruitment into the area of damage or inflammation. LIF has been implicate as an important factor for the development of the early embryo. LIF may also play a role in immune tolerance at the maternal-fetal interface. LIF supports the maintenance of mouse embryonic stem (ES) cell pluripotency and germline competency. LIF binds to the LIF receptor (LIFRα), which forms a heterodimer with a common β-subunit, GP130. This leads to activation and transduction of the JAK/STAT and MAPK signaling cascades. LIF is known as a direct transcriptional target of STAT5: STAT5 binds to LIF promoter and LIF expression is up-regulated after activation of the JAK2/STAT5 pathway.  The LIF expression is significantly increased in patients with chronic myeloproliferative neoplasms. Owning to its pleiotropic functions, LIF has been involved in the pathogenesis of many diseases of various origins.  Human LIF shows 80% sequence identity to mouse LIF.

 

Product Details

 

Gene Symbol: LIF; CDF; DIA; HILDA; MLPLI

 

NCBI Gene ID: 3976

 

Uniprot Entry: P15018

 

Construct Details: The recombinant human LIF-Fc fusion is expressed as a 419amino acid protein consisting of Ser23 - Phe202 region of (UniProt accession #P15018) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.

 

Source: Human cells stably expressing human LIF-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFH

ANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHV

DVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAFGSTTENLYFQGSTGTHTCPPCPAPELLGGPSVF

LFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD

WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWES

NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 46.5; Estimated by SDS-PAGE under reducing condition (kDa): 60-65 (probably due to glycosylation)

 

Calculated PI: 8.68

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  48080

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED₅₀ typically 0.1 - 0.2 ng/ml.  Induce IL-6 secretion in M1 mouse myeloid leukemia cells.  Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. EMBO J. 6:3995-4002 (1987)

2. Nature 336:690-692 (1988)

3. Proc. Natl. Acad. Sci. 85:2623-2627 (1988) 

4. Cell 77:1101-1116 (1994)

5. Nat. Biotechnol. 22:707-716 (2004) 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1697-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.