The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death.  The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal.  Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. The type I receptors are also referred to as ALKs (activin receptor-like kinases). Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. BMPR1B (BMP receptor type IB), also known as ALK6 and CDw293, is a type I receptor for BMPs that are involved in endochondral bone formation and embryogenesis. BMPR1B is expressed in various tissues during embryogenesis but only found in the brain in adult tissues. The extracellular domain of BMPR1B shares little amino acid sequence identity with other TGFBRs, except the cysteine residues are conserved. BMPR1B is involved in pre-cartilaginous condensations. Soluble BMPR1B binds BMP4 and is a potent BMP4 antagonist. Mutations in BMPR1B are associated with primary pulmonary hypertension, acromesomelic chondrodysplasia with genital anomalies (AMDGA) and brachydactyly A2 (BDA2). Reduced BMPR1B expression correlates with a poor prognosis of breast cancer.  

The TGFβ (transforming growth factor β) superfamily proteins are pleiotropic cytokines that regulate a diverse range of cellular processes, including proliferation, differentiation, migration, adhesion and death.  The TGFβ superfamily elicits 4 signaling pathways: TGFβ, Bone Morphogenic Protein (BMP), Activin, and Nodal.  Each pathway signals through a heteromeric receptor complex composed of at least two type-I and two type-II transmembrane receptors containing cytoplasmic serine/threonine kinase domains. These receptors are distinguished by the presence of a glycine/serine-rich juxta-membrane domain found only in the type I receptors. The type I receptors are also referred to as ALKs (activin receptor-like kinases). Either type receptor may initially bind ligand, followed by the recruitment of an alternate-type receptor counterpart to form a signal-activating complex. BMPR1B (BMP receptor type IB), also known as ALK6 and CDw293, is a type I receptor for BMPs that are involved in endochondral bone formation and embryogenesis. BMPR1B is expressed in various tissues during embryogenesis but only found in the brain in adult tissues. The extracellular domain of BMPR1B shares little amino acid sequence identity with other TGFBRs, except the cysteine residues are conserved. BMPR1B is involved in pre-cartilaginous condensations. Soluble BMPR1B binds BMP4 and is a potent BMP4 antagonist. Mutations in BMPR1B are associated with primary pulmonary hypertension, acromesomelic chondrodysplasia with genital anomalies (AMDGA) and brachydactyly A2 (BDA2). Reduced BMPR1B expression correlates with a poor prognosis of breast cancer.  

 

Product Details

 

Gene Symbol: BMPR1B; CDw293; ALK6; ALK-6; BMPR-1B; BMPRIB; BMPR-IB

 

NCBI Gene ID: 658

 

Uniprot Entry: O00238

 

Construct Details: The recombinant human BMPR1B-Fc fusion protein is expressed as a 342 amino acid protein consisting of Lys14 - Arg126 region of BMPR1B (UniProt accession #O00238) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition

 

Source: Human cells stably expressing human BMPR1B-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

KKEDGESTAPTPRPKVLRCKCHHHCPEDSVNNICSTDGYCFTMIEEDDSGLPVV

TSGCLGLEGSDFQCRDTPIPHQRRSIECCTERNECNKDLHPTLPPLKNRDFVDG

PIHHRASTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS

HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKC

KVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPS

DIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMH

EALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~45

 

Calculated PI: 6.29

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  37900

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Recombinant BMPR1B protein binds human BMP4 and blocks BMP4-induced signaling activity (e.g., alkaline phosphatase production in chondrogenic cells)

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Biol. Chem. 279:27560 (2004).

2. Proc. Natl. Acad. Sci. 100:12277(2003) 

3. J. Med. Genet. 42:314-317(2005). 

4. Proc. Natl. Acad. Sci. 102:5062(2005).

5. Cancer Genomics Proteomics 6:101(2009).

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0498B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.