RSPO1 (R-Spondin 1, Roof plate-specific Spondin 1), also known as Cristin 3, is a secreted protein belonging to the R-Spondin (RSPO) family. It shares ~40% amino acid identity with three other RSPO family members, which all contain two cystein-rich, furin-like domains and one thrombospondin type 1 domain. RSPO1 is expressed in early development at the roof plate boundary and is implicated in dorsal neural tube development. Postnatally, RSPO1 is expressed by neuroendocrine cells in the intestine, adrenal gland and pancreas, and by epithelia in kidney and prostate. In humans, rare disruptions of the RSPO1 gene are associated with a recessive syndrome characterized by XX sex reversal, palmoplantar hyperkeratosis and predisposition to squamous cell carcinoma of the skin. In mice, RSPO1 induces the rapid onset of crypt cell proliferation and increases intestinal epithelial healing, providing a protective effect against chemotherapy-induced colitis. RSPO1 acts both in the canonical Wnt/β-catenin-dependent pathway, possibly via a direct interaction with Wnt proteins, and in a Wnt-independent β-catenin pathway through a receptor pathway that may not use frizzled/LRP receptors. RSPO1 is known as a ligand for frizzled FZD8 and LRP6. However RSPO1 does not directly activate LRP6. It regulates cellular responsiveness to Wnt ligands by modulating the cell-surface levels of the co-receptor LRP6. RSPO1 may negatively regulate the TGFβ signaling pathway. In addition RSPO1 may paly an essential roles in ovary determination.
Gene Symbol: RSPO1; hRspo1; RSPO; CRISTIN3
NCBI Gene ID: 284654
Uniprot Entry: Q2MKA7
Construct Details: The recombinant human RPSO1 is expressed as a 264 amino acid protein consisting of Ser21 - Ala263 region of (UniProt accession #Q2MKA7) and a and a C-terminal His-tag. It contains potential sites for N-linked glycosylation.
Source: Human cells stably expressing human RSPO1 and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDAR
NPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWS
PWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRE
NANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPASTTENLYFQGSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 29.3; Estimated by SDS-PAGE under reducing condition (kDa): ~45
Calculated PI: 9.38
Calculated extinction coefficients (M-1 cm-1, at 280nm): 18335
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Synergizes with Wnt3a to stabilize β-catenin protein levels and induces the activation of β-catenin responsive reporter gene in HEK293 cells
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Nature Genetics. 38: 1304-9 (2206).
2. Nature genetics. 38:1233-4 (2006).
3. Proc Natl Acad Sci. 104: 14700-5 (2007).
4. Science 309: 1256 (2005).
5. Proc Natl Acad Sci. 106: 2331-6 (2009).
6. J. Biol. Chem. 281:13247 (2006).
Product datasheet (pdf) can be downloaded here: FCL1221-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services