Human MANF protein, recombinant

Description

MANF (mesencephalic astrocyte-derived neurotrophic factor), also known as ARMET (arginine-rich protein mutated in early stage tumors) and ARP (arginine-rich protein), belongs to the ARMET family.  The MANF gene is located on chromosome 3p21.1, a region that is frequently deleted in a variety of solid tumors.  MANF is localized in the endoplasmic reticulum (ER) and golgi, and is also secreted.  MANF protects rat embryonic nigral dopaminergic neurons and restores motor function in a rat model of Parkinson’s disease (PD), a movement disorder with characteristic degeneration of dopaminergic neurons.  MANF is also known to inhibit cell proliferation and ER stress-induced cell death.  The crystal structure shows that MANF consists of two domains, an amino-terminal saposin-like domain that may interact with lipids or membranes and be responsible for its neurotrophic activity, and a presumably unfolded carboxy-terminal domain that may protect cells against ER stress.  MANF has also been identified as one of genes in the heart that can be induced and secreted in response to ER stresses such as ischemia.  Circulating MANF may protect cardiac myocytes in an antocrine and paracrine manner.  MANF is also upregulated in cerebral ischemia in rats and may have neuroprotective effects against cerebral ischemia.  Human MANF is synthesized as a 179 amino acid precursor, which is processed to a mature form of 158 amino acids. Human MANF is 99% and 98% amino acid identical to rat and mouse MANF, respectively.

 

 

Gene Symbol: MANF; ARP; ARMET; MGC142148; MGC142150

 

NCBI Gene ID: 7873 

 

Uniprot Entry: P55145

 

Construct Details: The recombinant human MANF protein is expressed as a 169 amino acid protein consisting of Leu22 - Leu179 region of MANF and a C-terminal poly-Histidine tag

 

Source: Human cells stably expressing MANF and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence: 

LRPGDCEVCISYLGRFYQDLKDRDVTFSPATIENELIKFCREARGKENRLCYYIGATDDAATKIINEVSKPLAHHIPVEK

ICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCKGCAEKSDYIRKINELMPKYAPKAASARTDLST

GHHHHHHHH

 

M.W.: Calculated molecular mass 19.5 kDa; estimated by SDS-PAGE under reducing condition ~22 kDa with higher molecular mass smear probably due to glycosylation

 

Calculated PI: 8.55

 

Calculated Extinction Coefficient: 16430 (M^-1 cm^-1, at 280nm)

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, sample is labeled as "S" and "M" stands for markers)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free)

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: MANF is reported to promote the survival and to stimulate neurite outgrowth of rat embryonic cortical neurons with a typical ED₅₀ of 0.7 - 2.8 μg/ml

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

 

1. Develop Neurobiol 70: 360, 2010

2. Protein Engineering, Design & Selection 22: 233, 2009

3. J Neuroscience 29: 9651, 2009

4. J Comp Neurol 515: 116, 2009

 

 

Product datasheet (pdf) can be downloaded here: FCL0191-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.