Human OSM protein, Fc-fusion, biotinylated, recombinant
Oncostatin M (OSM) is a member of a cytokine family that includes leukemia-inhibitory factor (LIF), granulocyte colony-stimulating factor (G-CSF), and interleukin 6 (IL-6). The human OSM gene encodes a 252-aa pre-pro-OSM polypeptide with a 25-aa signal peptide and a C-terminal domain that are proteolytically processed to generate the 196-aa mature & active form. OSM is a pleiotropic cytokine that signals through cell surface type I and typ II receptors, which share the similarity to gp130, a signal transducing component of the IL-6, LIF and ciliary neurotrophic factor (CNTF) receptor complexes. OSM plays roles in liver development, hematopoeisis, inflammation, bone formation and destruction, and CNS development. OSM was originally identified by its ability to inhibit the growth of cells from melanoma and other solid tumors. It mediates cytokine production, including IL-6, G-CSF and GM-CSF from endothelial cells. Like LIF, IL-6 and G-CSF, OSM has the ability to inhibit the proliferation of murine M1 myeloid leukemic cells and induce their differentiation into macrophage-like cells. OSM is found primarily in activated T-lymphocyte and monocyte contributing to inflammation. OSM also has growth stimulatory activities on normal fibroblasts, sarcoma cells, and human erythroleukemia cell line, TF-1. Both OSM and LIF are expressed in the uterus around the time of implantation and considered as important factors for the development of early embryos. As a closely related cytokine to LIF, OSM mimics the activity of LIF in the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
Gene Symbol: OSM
NCBI Gene ID: 5008
Uniprot Entry: P13725
Construct Details: The recombinant human OSM-Fc is expressed as a 433-amino acid active form consisting of Ala26 - Arg220 region of (UniProt accession #P13725) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
Source: Human cells stably expressing human OSM-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
AAIGSCSKEYRVLLGQLQKQTDLMQDTSRLLDPYIRIQGLDVPKLREHCRERPGAFPSEETLRGLGRRGFLQTLNATLGC
VLHRLADLEQRLPKAQDLERSGLNIEDLEKLQMARPNILGLRNNIYCMAQLLDNSDTAEPTKAGRGASQPPTPTPASDAF
QRKLEGCRFLHGYHRFMHSVGRVFSKWGESPNRSRSTTENLYFQGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMIS
RTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEK
TISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDK
SRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 48.7; Estimated by SDS-PAGE under reducing condition (kDa): ~55
Calculated PI: 9.22
Calculated extinction coefficients (M-1 cm-1, at 280nm): 48985
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Stimulates TF-1 human erythroleukemic cell proliferation assay with an ED50 typically 0.2 - 0.5 ng/ml. Supports the maintenance of embryonic stem (ES) cell pluripotency and germline competency.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Proc. Natl. Acad. Sci. 83:9739-9743 (1986)
2. Mol. Cell. Biol. 9: 2847-53 (1989).
3. Proc. Natl. Acad. Sci. 88:8641-5 (1991).
4. J. Clin. Invest. 100: 158-68 (1997).
Product datasheet (pdf) can be downloaded here: FCL1626B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.