Human FGFR1 Protein, ECD (Extracellular Domain), Recombinant
FGFR1 (fibroblast growth factor receptor 1), also known as FLT-2 and CD331, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)like domains, an acidbox region, a transmembrane domain and a cytoplasmic tyrosinekinase domain. FGFR1 is the receptor for FGF basic and also interacts with GRB14, SHB, FRS2. The extracellular region of FGFR1 interacts with FGFs, setting in motion a cascade of downstream signals, ultimately leading to mitogenesis and differentiation. FGFR1 plays an essential role in the regulation of embryonic development, cell proliferation, differentiation and migration. It is required for normal mesoderm patterning and correct axial organization during embryonic development, normal skeletogenesis and normal development of the gonadotropin-releasing hormone (GnRH) neuronal system. Defects in FGFR1 are the cause of several diseases, such as Kallmann syndrome type 2 (KAL2), osteoglophonic dysplasia (OGD), and Pfeiffer syndrome (PF). Chromosomal aberrations involving FGFR1 are associated with stem cell leukemia lymphoma syndrome (SCLL) and stem cell myeloproliferative disorder (MPD).
Gene Symbol: FGFR1; CD331; FGFR-1; CEK; FLG; HH2; OGD; c-Fgr; FLT2; KAL2; BFGFR; FGFBR; FLT-2; HBGFR; N-SAM; HRTFDS; bFGF-R-1
NCBI Gene ID: 2260
Uniprot Entry: P11362
Construct Details: The recombinant human FGFR1 ECD protein is expressed as a 275 amino acid protein consisting of Arg22 - Glu285 region of FGFR1 (Uniprot accession #P11362 - isoform 15) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions. It contains 6 potential N-linked glycosylation sites.
Source: Human cells stably expressing FGFR1 ECD and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
RPSPTLPEQDALPSSEDDDDDDDSSSEEKETDNTKPNPVAPYWTSPEKMEKKLHAVPAAKTVKFK
CPSSGTPNPTLRWLKNGKEFKPDHRIGGYKVRYATWSIIMDSVVPSDKGNYTCIVENEYGSINHT
YQLDVVERSPHRPILQAGLPANKTVALGSNVEFMCKVYSDPQPHIQWLKHIEVNGSKIGPDNLPY
VQILKTAGVNTTDKEMEVLHLRNVSFEDAGEYTCLAGNSIGLSHHSAWLTVLEALEERPAVMTSP
LYLESTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 30.8; Estimated by SDS-PAGE under reducing condition (kDa): ~55
Calculated PI: 5.83
Calculated extinction coefficients (M-1 cm-1, at 280nm): 42650
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. J. Biol. Chem. 271: 1726-1731 (1996).
2. Biochem. Cell Biol. 75:669 (1997).
3. Proc. Natl. Acad. Sci. 97: 49-54 (2000).
4. Nature. 407: 1029-1034 (2000).
5. Nature Genetics. 39: 870-874 (2007).
Product datasheet (pdf) can be downloaded here: FCL0695-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.