Smaller Font Default Font Larger Font

You are here:

PrintEmail
In Stock

Human VEGF Protein, Isoform 165, Biotinylated, Recombinant

Product ID: VEGF165-Biot (SKU#: FCL0406B)

For Bulk Order: Call for price

Price:
$527.00
Size

Description

VEGF, also known as VEGF-A (vascular endothelial growth factor A) and VPF (vascular permeability factor), is the founding member of the VEGF family, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF.  VEGFs are secreted polypeptides with a highly conserved receptor-binding cystine-knot structure similar to that of the platelet-derived growth factors (PDGF).  VEGF plays important roles in vascular development and in diseases involving abnormal growth of blood vessels such as tumor-related angiogenesis.  VEGF is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. It induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and increases permeabilization of blood vessels. VEGF is involved in normal and pathological angiogenesis, a process that is associated with inflammation, wound healing, embryonic development, growth and metastasis of solid tumors. Elevated levels of VEGF have been detected in patients with cancer and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. VEGF is known to bind to the FLT1 (VEGFR1) and KDR (VEGFR2) receptors, heparan sulfate and heparin.  Targeting VEGF signaling pathway has shown therapeutic benefits in multiple cancer types. Alternately spliced VEGF isoforms of 121, 145, 165, 183, 189, and 206 amino acids in length exist in human. VEGF165 appears to be the most abundant isoform, followed by VEGF121 and VEGF189. Isoforms other than VEGF121 contain basic heparin­binding regions and are thus not freely diffusible. Human and cynomolgus VEGF165 are identical.  

 

VEGF, also known as VEGF-A (vascular endothelial growth factor A) and VPF (vascular permeability factor), is the founding member of the VEGF family, including VEGF-A, VEGF-B, VEGF-C, VEGF-D, VEGF-E, and PIGF.  VEGFs are secreted polypeptides with a highly conserved receptor-binding cystine-knot structure similar to that of the platelet-derived growth factors (PDGF).  VEGF plays important roles in vascular development and in diseases involving abnormal growth of blood vessels such as tumor-related angiogenesis.  VEGF is a growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. It induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and increases permeabilization of blood vessels. VEGF is involved in normal and pathological angiogenesis, a process that is associated with inflammation, wound healing, embryonic development, growth and metastasis of solid tumors. Elevated levels of VEGF have been detected in patients with cancer and autoimmune diseases, such as rheumatoid arthritis, multiple sclerosis, and systemic lupus erythematosus. VEGF is known to bind to the FLT1 (VEGFR1) and KDR (VEGFR2) receptors, heparan sulfate and heparin.  Targeting VEGF signaling pathway has shown therapeutic benefits in multiple cancer types. Alternately spliced VEGF isoforms of 121, 145, 165, 183, 189, and 206 amino acids in length exist in human. VEGF165 appears to be the most abundant isoform, followed by VEGF121 and VEGF189. Isoforms other than VEGF121 contain basic heparin­binding regions and are thus not freely diffusible. Human and cynomolgus VEGF165 are identical.  

 

Product Details

 

Gene Symbol: VEGF; VEGFA; VEGF-A; VPF; MVCD1

 

NCBI Gene ID: 7422 (human), 22339 (mouse)

 

Uniprot Entry: P15692 (human), Q00731 (mouse)

 

Construct Details: Human VEGF165, also known as VEGF, is expressed as a 176-amino acid protein consisting of the region Ala27- Arg191 of VEGF (UniProt Accession #P15692-4, isoform VEGF165) and a C-terminal His-tag. It contains 1 potential sites for N-linked glycosylation and exists as a dimer under non-reducing condition (see the gel image inserted).

 

Source: Mammalian cells stably expressing human VEGF165 and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence: 

APMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRC

GGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQE

NPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRRSTGHHH

HHHHH

  

M.W.: Calculated molecular mass (kDa): 20.5; Estimated by SDS-PAGE under reducing condition (kDa): ~30 (probably due to glycosylation)

 

Calculated PI: 7.66

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  6960

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "DTT: +")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds its receptors (FLT1,  KDR) and anti-VEGF monoclonal antobodies (SKU#MAB0345, MAB0337 ) with high affinity  (KD < 10 nM as measured by ELISA). Stimulates HUVEC (human umbilical vein endothelial cells) proliferation and certain tumor cell growth.

 

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Science 246:1306-1309, 1989
2. Science 246:1309-1312, 1989
3. Nature 362: 841-844, 1993
4. Semin Oncol 29:10–14, 2002
5. J Biol Chem 281: 6625–31,2006

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here. FCL0406B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class Angiogenic Growth Factor (secreted)
Gene Family PDGF/VEGF Growth Factor Family
Gene Synonym VEGFA; VEGF-A; VPF; MVCD1
Research Area Angiogenesis
"A" - "Z" List
V
Pathway/Disease VEGF Signaling Pathway
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services