Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human HER3 protein (extracellular domain), recombinant

Product ID: HER3 ECD (SKU#: FCL0261)

For Bulk Order: Call for price

Price:
$597.00
Size

Description

HER3 is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK).  Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4).  They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity.  EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation.  Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.  HER3 binds neuregulins NRG1 and NRG2, but lacks an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation.  However, heterodimerization with other EGF receptor family members, which have kinase activity, leads to the activation of pathways.  Amplification or overexpression of this gene has been reported in several cancers, including lung, prostate, bladder, and breast tumors.  HER3 is also genetically linked to type 1 diabetes and lethal congenital contracture syndrome-2 (LCCS2).

 

HER3 is a member of the epidermal growth factor receptor (EGFR) family of receptor tyrosine kinases (RTK).  Four members of the EGFR family have been identified: EGFR (ERBB1, HER1), HER2 (ERBB2), HER3 (ERBB3) and HER4 (ERBB4).  They typically contain an extracellular ligand binding domain (ECD), a transmembrane domain (TM), and an intracellular kinase domain that can interact with a multitude of signaling molecules and exhibit both ligand-dependent and ligand-independent activity.  EGFR signaling is initiated by ligand binding to the extracellular ligand binding domain. This initiates receptor homo-/hetero-dimerization and autophosphorylation by the intracellular kinase domain, resulting in receptor activation.  Following activation, phosphorylation of cytoplasmic substrates occurs and a signaling cascade is initiated that drives many cellular responses, including changes in gene expression, cytoskeletal rearrangement, anti-apoptosis and increased cell proliferation.  HER3 binds neuregulins NRG1 and NRG2, but lacks an active kinase domain. It therefore can bind this ligand but not convey the signal into the cell through protein phosphorylation.  However, heterodimerization with other EGF receptor family members, which have kinase activity, leads to the activation of pathways.  Amplification or overexpression of this gene has been reported in several cancers, including lung, prostate, bladder, and breast tumors.  HER3 is also genetically linked to type 1 diabetes and lethal congenital contracture syndrome-2 (LCCS2).

 

Product Details

 

Gene Symbol: HER3; ERBB3; LCCS2; ErbB-3; c-erbB3; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3

 

NCBI Gene ID: 2065 (human)

 

Uniprot Entry: P21860 (human)

 

Construct Details: The recombinant human HER3 extracellular or ecto-domain (ECD) is expressed as a 635 amino acid protein consisting of Ser20-Thr643 region of HER3 and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions

 

Source: Human cells stably expressing HER3 ECD and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SEVGNSQAVCPGTLNGLSVTGDAENQYQTLYKLYERCEVVMGNLEIVLTGHNADLSFLQWIREVTGYVLVAMNEFSTLPLPNL

RVVRGTQVYDGKFAIFVMLNYNTNSSHALRQLRLTQLTEILSGGVYIEKNDKLCHMDTIDWRDIVRDRDAEIVVKDNGRSCPP

CHEVCKGRCWGPGSEDCQTLTKTICAPQCNGHCFGPNPNQCCHDECAGGCSGPQDTDCFACRHFNDSGACVPRCPQPLVYNKL

TFQLEPNPHTKYQYGGVCVASCPHNFVVDQTSCVRACPPDKMEVDKNGLKMCEPCGGLCPKACEGTGSGSRFQTVDSSNIDGF

VNCTKILGNLDFLITGLNGDPWHKIPALDPEKLNVFRTVREITGYLNIQSWPPHMHNFSVFSNLTTIGGRSLYNRGFSLLIMK

NLNVTSLGFRSLKEISAGRIYISANRQLCYHHSLNWTKVLRGPTEERLDIKHNRPRRDCVAEGKVCDPLCSSGGCWGPGPGQC

LSCRNYSRGGVCVTHCNFLNGEPREFAHEAECFSCHPECQPMEGTATCNGSGSDTCAQCAHFRDGPHCVSSCPHGVLGAKGPI

YKYPDVQNECRPCHENCTQGCKGPELQDCLGQTLVLIGKTHLTSTGHHHHHHHH

 

M.W.: Calculated molecular mass (kDa): 70.0; Estimated by SDS-PAGE under reducing condition (kDa): ~75

 

Calculated PI: 6.66

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  66955

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity:  It is reported to inhibit the biological activity of Neuregulin-1 on MCF‑7 human breast cancer cells

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1.  J. Biol. Chem. 269: 14303-14306, 1994.
2.  Science 297: 1330-1333, 2002.
3.  Science 316: 1039-1043, 2007.
4.  Proc. Nat. Acad. Sci. 86: 9193-9197, 1989.
5.  Nature Genet. 40: 1399-1401, 2008.

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0261-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class Receptor Tyrosine Kinase (RTK)
Gene Family Tyrosine Protein Kinase Family; EGF Receptor (EGFR) Subfamily
Gene Synonym HER3; ERBB3; LCCS2; ErbB-3; c-erbB3; MDA-BF-1; p180-ErbB3; p45-sErbB3; p85-sErbB3
Research Area Cancer
"A" - "Z" List
H
Pathway/Disease EGF/PDGF Signaling Pathway
Species
Human

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services