FGFR4 (fibroblast growth factor receptor 4), also known as JTK2 and CD334, is a single-pass type I transmembrane protein that belongs to the FGFR subfamily of the receptor tyrosine kinase (RTK) family. There are 4 distinct members (FGFR1-4) that differ from one another in their ligand affinities, tissue distribution and biological functions. FGFRs mediate the biological activities of a group of at least 23 structurally related FGFs, including cell growth, differentiation, angiogenesis, wound healing, and tumorigenesis. All 4 FGFR members are composed of a signal peptide, 3 immunoglobulin (Ig)like domains, an acidbox region, a transmembrane domain and a cytoplasmic tyrosinekinase domain. FGFR4 is reported to be a high affinity receptor for both acidic and basic fibroblast growth factor, and also binds to FGF8, 15, and 19. FGFR4 associates with βKlotho and sulfated glycosaminoglycans, and these interactions increase the affinity of FGFR4 for its ligands and its signaling capacity. Growing studies have indicated that FGFR4 plays a role in tumor progression in human cancer. It plays a role in the regulation of cell proliferation, differentiation and migration, and in regulation of lipid metabolism, bile acid biosynthesis, glucose uptake, vitamin D metabolism and phosphate homeostasis. FGFR4 supports glucose tolerance and insulin sensitivity and protects against hyperlipidemia.
Gene Symbol: FGFR4; CD334; FGFR-4; TKF; JTK2; JTK-2
NCBI Gene ID: 2264
Uniprot Entry: P22455
Construct Details: The recombinant human FGFR4 ECD is expressed as a 360 amino acid protein consisting of Leu22 - Asp369 region of FGFR4 (Uniprot accession #P22455 - isoform 1) and a C-terminal poly-His tag, which exists as a monomer under reducing and non-reducing conditions (see the gel image inserted).
Source: Human cells stably expressing FGFR4 ECD and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
LEASEEVELEPCLAPSLEQQEQELTVALGQPVRLCCGRAERGGHWYKEGSRLAPAGRVRGWRGR
LEIASFLPEDAGRYLCLARGSMIVLQNLTLITGDSLTSSNDDEDPKSHRDPSNRHSYPQQAPYW
THPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHWSLVMES
VVPSDRGTYTCLVENAVGSIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDVELLCKVYSDA
QPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAEDAGEYTCLAGNSIGL
SYQSAWLTVLPEEDPTWTAAAPEARYTDGSTGHHHHHHHH
M.W.: Calculated molecular mass (kDa): 39.9; Estimated by SDS-PAGE under reducing condition (kDa): 50-60
Calculated PI: 6.01
Calculated extinction coefficients (M-1 cm-1, at 280nm): 63870
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds and inhibits aFGF / FGF-acidic dependent proliferation of mouse fibroblast cells.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. EMBO. J. 10: 1347-1354 (1991).
2. J. Biol. Chem. 268:5388-5394 (1993).
3. Development 113:641 (1991).
4. Cancer. Res. 62: 840-847 (2002).
5. Diabetes 56:2501 (2007).
Product datasheet (pdf) can be downloaded here: FCL0692B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services