Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human CD44 Protein, ECD (Extracellular Domain), Fc-fusion, Biotinylated, Recombinant

Product ID: CD44-Fc-Biot (SKU#: FCL0049B)

For Bulk Order: Call for price

Price:
$528.00
Size

Description

CD44 is a single-pass type I transmembrane glycoprotein in the cartilage link protein family.  CD44 exists in multiple spliced forms with enormous variability in glycosylation. CD44 can range from 80 to 200 kDa in size. In the extracellular domain, CD44 has a hyaluronan­binding disulfide­stabilized link region and a stem region with 10 variably spliced exons (v1 ­ 10, exons 6 ­ 15). The standard or hematopoietic form, CDw44, does not contain the variable segments. CD44 binds a variety of ligands in cell-cell and cell-matrix interactions and signal transduction. CD44 is the major receptor for hyaluronan to regulate cell migration, tumor growth and progression.  CD44 is involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. The binding of CD44 to hyaluronan is induced on T lymphocytes after activation by antigen and on monocytes after stimulation by pro-inflammatory agents. CD44 acts as a “platform” for growth factors and metalloproteinases. CD44 can also function as a co­receptor that modulates the activity of receptors such as c-MET and EGFR family of tyrosine kinases. CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form or can be cleaved at multiple sites by matrix metalloproteinases (MMPs). These cleavage events may promote metastasis by enhancing tumor cell motility and growth. Abnormal expression or dysfunction of CD44 causes numerous pathogenic phenotypes. The expression of specific CD44 isoforms correlates with cancer aggressiveness and T cell activation. 

 

CD44 is a single-pass type I transmembrane glycoprotein in the cartilage link protein family.  CD44 exists in multiple spliced forms with enormous variability in glycosylation. CD44 can range from 80 to 200 kDa in size. In the extracellular domain, CD44 has a hyaluronan­binding disulfide­stabilized link region and a stem region with 10 variably spliced exons (v1 ­ 10, exons 6 ­ 15). The standard or hematopoietic form, CDw44, does not contain the variable segments. CD44 binds a variety of ligands in cell-cell and cell-matrix interactions and signal transduction. CD44 is the major receptor for hyaluronan to regulate cell migration, tumor growth and progression.  CD44 is involved in lymphocyte activation, recirculation and homing, and in hematopoiesis. The binding of CD44 to hyaluronan is induced on T lymphocytes after activation by antigen and on monocytes after stimulation by pro-inflammatory agents. CD44 acts as a “platform” for growth factors and metalloproteinases. CD44 can also function as a co­receptor that modulates the activity of receptors such as c-MET and EGFR family of tyrosine kinases. CD44 intracellular domain links the plasma membrane to the actin cytoskeleton via the ERM proteins, ezrin, radixin and moesin. CD44 can be synthesized in a soluble form or can be cleaved at multiple sites by matrix metalloproteinases (MMPs). These cleavage events may promote metastasis by enhancing tumor cell motility and growth. Abnormal expression or dysfunction of CD44 causes numerous pathogenic phenotypes. The expression of specific CD44 isoforms correlates with cancer aggressiveness and T cell activation. 

 

Product Details

 

Gene Symbol: CD44; IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; PGP-I; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III

 

NCBI Gene ID: 960

 

Uniprot Entry: P16070

 

Construct Details: The recombinant human CD44-Fc is expressed as a 470 amino acid protein consisting of Gln21 - Thr263 region of CDw44 (UniProt accession #P16070 - isoform 12 or CDw44) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition (see the gel image inserted).

 

Source: Human cells stably expressing human CD44-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence: 

QIDLNITCRFAGVFHVEKNGRYSISRTEAADLCKAFNSTLPTMAQMEKALSIGFETCRYGF

IEGHVVIPRIHPNSICAANNTGVYILTSNTSQYDTYCFNASAPPEEDCTSVTDLPNAFDGP

ITITIVNRDGTRYVQKGEYRTNPEDIYPSNPTDDDVSSGSSSERSSTSGGYIFYTFSTVHP

IPDEDSPWITDSTDRIPATRDQDTFHPSGGSHTTHGSESDGHSHGSQEGGANTTSGPIRTD

KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGV

EVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQP

REPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF

FLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

  

M.W.: Calculated molecular mass (kDa): 52; Estimated by SDS-PAGE under reducing condition (kDa): 80-90

 

Calculated PI: 5.52

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 56560

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "DTT: +")

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized CD44-Fc protein binds hyaluronan and anti-CD44 monoclonal antibodies, human IgG1 (SKU#MAB0503), mouse IgG2a (SKU#MAB0494) and rabbit IgG (SKU#MAB0492) with high affinity (KD < 1 nM) in a functional ELISA.

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Proc. Natl. Acad. Sci. 89:12160 (1992). 

2. J. Biol. Chem. 271:20603 (1996).

3. Oncogene 22:1511 (2003).

4. Nat. Rev. Immunol. 4:931 (2004). 

5. Cancer Res. 64:876 (2004). 

 

 



 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0049B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-Pass Type I Transmembrane
Gene Synonym IN; LHR; MC56; MDU2; MDU3; MIC4; Pgp1; PGP-I; CDW44; CSPG8; HCELL; HUTCH-I; ECMR-III
Gene Family Cartilage Link Protein Family
Research Area Cancer
"A" - "Z" List
C
Pathway/Disease Cell Adhesion
Species
Human
CD Antigen CD44

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services