Myeloid cell surface antigen CD329, also known as CDw329, FOAP-9 and SIGLEC-9, is a single-pass type I transmembrane protein belonging to the sialic acid binding Ig-like lectin (SIGLEC) family in the immunoglobulin superfamily (IgSF).  SIGLECs are characterized by an N-terminal Ig-like V-type domain that mediates sialic acid binding, followed by varying numbers (2 to 17) of Ig-like C2-type domains, a transmembrane region, and a cytoplasmic tail with intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIM). They can be classified into two subgroups: SIGLEC-1, -2, and -4 subgroup, and a SIGLEC-3/CD33-related subgroup (SIGLEC-3, and -5 through -13), defined by sequence similarity and clustered gene localization. SIGLECs are widely expressed on hematopoietic cells, often in a cell-type-specific manner. CD329/SIGLEC­9 is expressed on neutrophils, monocytes, a fraction of NK cells, B cells, and a minor subset of CD8+ T cells. It is also found in liver, fetal liver, bone marrow, placenta, spleen and in lower levels in skeletal muscle, fetal brain, stomach, lung, thymus, prostate, brain, mammary, adrenal gland, colon, trachea, cerebellum, testis, small intestine and spinal cordon. Unlike CD33, CD329/SIGLEC-9 binds equally well to both 2,3­ and 2,6­linked sialic acid. CD329/SIGLEC-9 contains 2 Ig-like C2-type and 1 Ig-like V-type domains in the extracellular region and a cytoplasmic immunoreceptor tyrosine-based inhibitor motif (ITIM). CD329/Siglec­9 is closely related to CD328/Siglec­7, and they share ~80% amino acid sequence identity. CD329/SLGLEC-9 may function as a putative adhesion molecule that mediates sialic-acid dependent binding to cells. 

Myeloid cell surface antigen CD329, also known as CDw329, FOAP-9 and SIGLEC-9, is a single-pass type I transmembrane protein belonging to the sialic acid binding Ig-like lectin (SIGLEC) family in the immunoglobulin superfamily (IgSF).  SIGLECs are characterized by an N-terminal Ig-like V-type domain that mediates sialic acid binding, followed by varying numbers (2 to 17) of Ig-like C2-type domains, a transmembrane region, and a cytoplasmic tail with intracellular immunoreceptor tyrosine-based inhibitory motifs (ITIM). They can be classified into two subgroups: SIGLEC-1, -2, and -4 subgroup, and a SIGLEC-3/CD33-related subgroup (SIGLEC-3, and -5 through -13), defined by sequence similarity and clustered gene localization. SIGLECs are widely expressed on hematopoietic cells, often in a cell-type-specific manner. CD329/SIGLEC­9 is expressed on neutrophils, monocytes, a fraction of NK cells, B cells, and a minor subset of CD8+ T cells. It is also found in liver, fetal liver, bone marrow, placenta, spleen and in lower levels in skeletal muscle, fetal brain, stomach, lung, thymus, prostate, brain, mammary, adrenal gland, colon, trachea, cerebellum, testis, small intestine and spinal cordon. Unlike CD33, CD329/SIGLEC-9 binds equally well to both 2,3­ and 2,6­linked sialic acid. CD329/SIGLEC-9 contains 2 Ig-like C2-type and 1 Ig-like V-type domains in the extracellular region and a cytoplasmic immunoreceptor tyrosine-based inhibitor motif (ITIM). CD329/Siglec­9 is closely related to CD328/Siglec­7, and they share ~80% amino acid sequence identity. CD329/SLGLEC-9 may function as a putative adhesion molecule that mediates sialic-acid dependent binding to cells. 

 

Product Details

 

Gene Symbol: CD329; CDw329; FOAP-9; Siglec9; Siglec-9; OBBP-LIKE; UNQ668/PRO1302

 

NCBI Gene ID: 27180

 

Uniprot Entry: Q9Y336

 

Construct Details: The recombinant human CD329-Fc is expressed as a 556 amino acid protein consisting of Gln18 - Gly348 region of CD329 and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

 

Source: Human cells stably expressing human CD329-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

QTSKLLTMQSSVTVQEGLCVHVPCSFSYPSHGWIYPGPVVHGYWFREGANTDQDA

PVATNNPARAVWEETRDRFHLLGDPHTKNCTLSIRDARRSDAGRYFFRMEKGSIK

WNYKHHRLSVNVTALTHRPNILIPGTLESGCPQNLTCSVPWACEQGTPPMISWIG

TSVSPLDPSTTRSSVLTLIPQPQDHGTSLTCQVTFPGASVTTNKTVHLNVSYPPQ

NLTMTVFQGDGTVSTVLGNGSSLSLPEGQSLRLVCAVDAVDSNPPARLSLSWRGL

TLCPSQPSNPGVLELPWVHLRDAAEFTCRAQNPLGSQQVYLNVSLQSKATSGVTQ

GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFN

WYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAP

IEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ

PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSL

SLSPGK

 

M.W.: Calculated molecular mass (kDa): 61.4; Estimated by SDS-PAGE under reducing condition (kDa): 80-90 (probably due to glycosylation)

 

Calculated PI: 7.90

 

Calculated extinction coefficients (M-1 cm-1, at 280nm): 90840

 

Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Immobilized protein supports the adhesion of human red blood cells. Blocks CD329-binding to its ligand and signaling activity.

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Genomics 67:171 (2000).

2. J. Biol. Chem. 275:22121 (2000).  

3. J. Biol. Chem. 275:22127 (2000). 

4. Immunology 103:137 (2001).  

5. J. Biol. Chem. 277:24466 (2002).  

 

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL0117B-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.