TIM3 (T cell immunoglobulin and mucin domain3), also known as HAVCR2, is a single-pass type I transmembrane glycoprotein of the TIM family of Ig superfamily. Like other family members, TIM-3 contains one Iglike Vtype domain and a Ser/Thrrich mucin stalk domain in the extracellular region. An alternatively spliced isoform is truncated within the mucinlike stalk. TIM-3 is selectively expressed on Th1 (T-helper type 1) cells but not on Th2 cells. Th1 cells produce cytokines (IFN-γ, interleukin-2, TNF-α and lymphotoxin) associated with cell-mediated immune responses against intracellular pathogens, delayed-type hypersensitivity, and induction of organ-specific autoimmunity. TIM3 is upregulated on activated myeloid cells and T cells. TIM-3 regulates macrophage activation and inhibits Th1-mediated auto- and allo-immune responses to promote immunological tolerance. It may be also involved in T-cell homing. Galectin9 has been identified as a ligand for TIM-3. The binding of Galectin-9 to TM-3 enhances immune tolerance and inhibits antitumor immunity. It can alternatively trigger immune stimulatory effects, such as the co-activation of NK cell cytotoxicity. TIM3 dampens inflammation by enabling the phagocytosis of apoptotic cells and the crosspresentation of apoptotic cell antigens. Dysregulation of the Galectin-9/TIM-3 pathway is implicated in many chronic autoimmune conditions in human, such as multiple sclerosis and systemic lupus erythematosus.
Gene Symbol: TIM-3; TIM3; TIMD3; TIMD-3; KIM-3; HAVCR2; HAVCR-2
NCBI Gene ID: 84868
Uniprot Entry: Q8TDQ0
Construct Details: The recombinant human TIM-3-Fc fusion protein is expressed as a 409 amino acid protein consisting of Ser22 - Gly202 region of TIM-3 (UniProt accession #Q8TDQ0) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells stably expressing human TIM-3-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLTIE
NVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPDINLTQ
ISTLANELRDSRLANDLRDSGATIRIGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHE
DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREP
QVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 45.6; Estimated by SDS-PAGE under reducing condition (kDa): ~65 (probably due to glycosylation).
Calculated PI: 7.04
Calculated extinction coefficients (M-1 cm-1, at 280nm): 61600
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as DTT "+")
Formulation: Supplied at 0.5 mg/ml in sterile PBSpH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule) using the standard procedure.
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Binds its ligand Galectin-9 and blocks Galectin-9/TIM-3 mediated signaling activity.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. Nature 415:536 (2002).
2. Nat. Immunol. 4:1093 (2003).
3. Nat. Immunol. 4:1102 (2003).
4. J. Exp. Med. 203:1413 (2006).
5. Science 318:1141 (2007).
Product datasheet (pdf) can be downloaded here: FCL0858B-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services