![](/images/stories/virtuemart/product/fcl0129.png)
CD99, also known as MIC2, HBA71 and T-cell surface glycoprotein E2, is a single-pass type I transmembrane protein, which is the founding member of the CD99 protein family, including CD99, CD99L2, and XG. Human CD99 contains a 100-aa extracellular domain (ECD) with no identifiable motifs, Nlinked glycosylation sites, or cysteine residues but with potential sites for Olinked glycosylation. The cytoplasmic region, albeit short, has signal transduction capability. CD99 is expressed on most hematopoietic cells, endothelial cells and at the borders between confluent cells. Cells known to express CD99 include fibroblasts, neutrophils, T cells, doublepositive thymocytes, CD34+ stem cells, monocytes and endothelial cells. There are multiple isoforms for human CD99, which appears to activate distinctive signal pathways and mediate different biological outcomes. CD99 may be a receptor for PILR-alpha and -beta, which are found on selected leukocytes. CD99 is involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. Homophilic interaction between CD99 on the neutrophil and on the endothelial cell regulates the transendothelial migration of neutrophils during inflammation. CD99 possesses the ability to rearrange the actin cytoskeleton and may function as an oncosuppressor in osteosarcoma. CD99 is a specific marker for Ewing's sarcoma, primitive neuroectodermal tumor, and sex cord-stromal tumors. The degree of CD99 reactivity correlates with the degree of differentiation in Sertoli-Leydig cell tumors.
Gene Symbol: CD99; MIC2; HBA71; MIC2X; MIC2Y; MSK5X; E2; 12E7
NCBI Gene ID: 4267
Uniprot Entry: P14209
Construct Details: The recombinant human CD99-Fc is expressed as a 329 amino acid protein consisting of Asp23 - Ala123 region of CD99 (UniProt #P14209 - isoform 1) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.
Source: Human cells stably expressing human CD99-Fc and growing in chemical-defined media with no animal components or antibiotics
Deduced Amino Acid Sequence:
DGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNH
PSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADASTGTHTCPPCPAPELLGGPSV
FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYR
VVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQ
VSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVF
SCSVMHEALHNHYTQKSLSLSPGK
M.W.: Calculated molecular mass (kDa): 35.7; Estimated by SDS-PAGE under reducing condition (kDa): 50-55
Calculated PI: 5.18
Calculated extinction coefficients (M-1 cm-1, at 280nm): 35785
Purity: >95% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "DTT: +")
Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).
Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method
Biological Activity: Immobilized CD99-Fc protein supports homophillic interaction with CD99 itself (e.g., via biotinylated CD99 protein) by a functional ELISA.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.
Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
1. EMBO J. 8:3253 (1989).
2. Blood 83:415 (1994).
3. J. Immunol. 159:2250 (1997).
4. Nat. Immunol. 3:143 (2002).
5. J. Exp. Med. 199:525 (2004).
6. J. Biol. Chem. 281:34833 (2006).
Product datasheet (pdf) can be downloaded here: FCL0129-PDS.pdf
Additional supporting documents, including COA and MSDS are available upon request.
FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.
Restriction: This product is not transferable or re-sellable. Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose. Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules. Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction. Your use of this product constitutes acceptance of the terms of this limited use agreement. Please refer to our “terms & conditions” for details. If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.
Earn discounts, credits or rewards with your purchases.
Get the sequence-verified, expression-ready gene clones.
Oder your high-quality, recombinant proteins of interest.
Try our products & services for your antibody R&D.
Acquire high titer, ready-to-use viral particles.
Send your question or feedback on our products & services