Smaller Font Default Font Larger Font

You are here:

PrintEmail

Human NCR3 Protein, ECD (Extracellular Domain), Fc-fusion, Recombinant

Product ID: NCR3-Fc (SKU#: FCL1080)

For Bulk Order: Call for price

Price:
$598.00
Size

Description

NCR3 (natural cytotoxicity triggering receptor 3), also known as NKp30 and CD337, is a single pass type I transmembrane glycoprotein that belongs to the NCR family of the Ig (immunoglobulin) superfamily. Like other family members, NCR3 contains a single Ig-like V-type domain in the extracellular region. Cytotoxicity of natural killer (NK) cells is regulated by a balance of signals from two types of NK receptors, activating receptors and inhibitory receptors. NCR3 is a major NK activating receptor. NCR3 is selectively expressed in all resting and activated NK cells.  It plays a key role in NK-mediated killing of tumor cells. NCR3 is also involved in NK-mediated induction of dendritic cell (DC) maturation. NCR3 forms a complex with an ITAM-bearing accessory protein CD3ζ, which undergoes phosphorylation upon a specific antibody ligation. Studies with neutralizing antibodies reveal that NCR3 is partially responsible for triggering lytic activity against several tumor cell types and that it is the main receptor responsible for NK­mediated lysis of immature dendritic cells. The B7 family member B7-H6 has been identified as a tumor cell ligand for the activating natural killer cell receptor NCR3 in humans.

 

NCR3 (natural cytotoxicity triggering receptor 3), also known as NKp30 and CD337, is a single pass type I transmembrane glycoprotein that belongs to the NCR family of the Ig (immunoglobulin) superfamily. Like other family members, NCR3 contains a single Ig-like V-type domain in the extracellular region. Cytotoxicity of natural killer (NK) cells is regulated by a balance of signals from two types of NK receptors, activating receptors and inhibitory receptors. NCR3 is a major NK activating receptor. NCR3 is selectively expressed in all resting and activated NK cells.  It plays a key role in NK-mediated killing of tumor cells. NCR3 is also involved in NK-mediated induction of dendritic cell (DC) maturation. NCR3 forms a complex with an ITAM-bearing accessory protein CD3ζ, which undergoes phosphorylation upon a specific antibody ligation. Studies with neutralizing antibodies reveal that NCR3 is partially responsible for triggering lytic activity against several tumor cell types and that it is the main receptor responsible for NK­mediated lysis of immature dendritic cells. The B7 family member B7-H6 has been identified as a tumor cell ligand for the activating natural killer cell receptor NCR3 in humans.

 

Product Details

 

Gene Symbol: NCR3; CD337; NKp30; NK-p30; 1C7; MALS; LY117; NCTR3; NCR-3

 

NCBI Gene ID: 259197

 

Uniprot Entry: O14931

 

Construct Details: The recombinant human NCR3-Fc fusion is expressed as a 345 amino acid protein consisting of Leu19 - Gly135 region of NCR3 (UniProt accession #O14931) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

 

Source: Human cells stably expressing human NCR3-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLH

DHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGSTGTHTCPPCPAPELLGGPSV

FLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL

HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIA

VEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

 

M.W.: Calculated molecular mass (kDa): 38.4; Estimated by SDS-PAGE under reducing condition (kDa): ~50

 

Calculated PI: 7.29

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  48400

 

Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Binds to its ligand B7-H6 (SKU#FCL1178) in a functional ELISA and blocks B7-H6-induced IFN-γ secretion by NK cells. 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. J. Exp. Med. 190:1505 (1999).

2. J. Exp. Med. 195:343 (2002). 

3. J. Immunol. 174:2653 (2005).

4. J. Immunol. 179:7385 (2007).

5. J. Exp. Med. 2061495 (2009)

 



 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1080-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Molecule Class 1-pass Type I Transmembrane
Gene Synonym NCR3; CD337; NKp30; NK-p30; 1C7; MALS; LY117; NCTR3; NCR-3
Gene Family Ig Superfamily; NCR Family
Research Area Immunology
"A" - "Z" List
N
Pathway/Disease NK Cell Activation
Species
Human
CD Antigen CD337

Search Products

Categories
Molecule Class
Gene Family
Pathway/Disease
Research Area
CD Antigen
"A" - "Z" List
Reset All

Special Offers & Rewards

Promotion

Earn discounts, credits or rewards with your purchases.

Purchase or Clone My Genes

My Gene Clones

Get the sequence-verified, expression-ready gene clones.

Recombinant Proteins

Recombinant Proteins

Oder your high-quality, recombinant proteins of interest.

Recombinant Antibodies

Recombinant Antibodies

Try our products & services for your antibody R&D.

Virus-Based Gene Expression

Virus Gene Delivery

Acquire high titer, ready-to-use viral particles.

Get in Touch with Us

Send your question or feedback on our products & services