sFRP1 (secreted frizzled-related protein 1), also known as FRP1 and SARP-2, is the founding member of the sFRP family. sFRP family consists of at least 5 secreted glycoproteins that act as extracellular signaling ligands. Each sFRP contains a signal peptide, a cysteine-rich domain (CRD) that shares 30-50% homology with that of Fz (Frizzled) receptors, and a C­terminal heparin­binding region with weak homology to NTR (Netrin). sFRPs function as soluble modulators of Wnt signaling, which plays a key role in embryonic development, cell differentiation and cell proliferation. sFRPs may counteract Wnt-induced effects at high concentrations and promote them at lower concentrations. sFRPs can bind Wnt proteins and Fz receptors in the extracellular compartment. The interaction between sFRPs and Wnt proteins prevents the latter from binding the Fz receptors. sFRP1 is widely expressed with highest levels in heart and fetal kidney. sFRP1 has diverse activities, from inducing angiogenesis  to helping regulate Wnt­4 signaling (with sFRP­2) in renal organogenesis . sFRP1 decreases intracellular beta-catenin levels  and exhibits antiproliferative effects on vascular cells. sFRP1 has been characterized as a tumor suppressor in breast and cervical cancer.  SFRP1 is also found in malignant gliomas and may contribute to the development of uterine leiomyomas.

sFRP1 (secreted frizzled-related protein 1), also known as FRP1 and SARP-2, is the founding member of the sFRP family. sFRP family consists of at least 5 secreted glycoproteins that act as extracellular signaling ligands. Each sFRP contains a signal peptide, a cysteine-rich domain (CRD) that shares 30-50% homology with that of Fz (Frizzled) receptors, and a C­terminal heparin­binding region with weak homology to NTR (Netrin). sFRPs function as soluble modulators of Wnt signaling, which plays a key role in embryonic development, cell differentiation and cell proliferation. sFRPs may counteract Wnt-induced effects at high concentrations and promote them at lower concentrations. sFRPs can bind Wnt proteins and Fz receptors in the extracellular compartment. The interaction between sFRPs and Wnt proteins prevents the latter from binding the Fz receptors. sFRP1 is widely expressed with highest levels in heart and fetal kidney. sFRP1 has diverse activities, from inducing angiogenesis  to helping regulate Wnt­4 signaling (with sFRP­2) in renal organogenesis . sFRP1 decreases intracellular beta-catenin levels  and exhibits antiproliferative effects on vascular cells. sFRP1 has been characterized as a tumor suppressor in breast and cervical cancer.  SFRP1 is also found in malignant gliomas and may contribute to the development of uterine leiomyomas.

 

Product Details

 

Gene Symbol: sFRP1; sFRP-1; FRP; FRP1; FrzA; FRP-1; SARP2; SARP-2

 

NCBI Gene ID: 6422

 

Uniprot Entry: Q8N474

 

Construct Details: The recombinant human sFRP1-Fc is expressed as a 511-amino acid active form consisting of Ser32 - Lys314 region of sFRP1 (UniProt accession #Q8N474) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.  

 

Source: Human cells stably expressing human sFRP1-Fc and growing in chemical-defined media with no animal components or antibiotics

 

Deduced Amino Acid Sequence:

SEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNK

NCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNAT

EASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLV

LYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFKSTGTH

TCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY

NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCL

VKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS

LSLSPGK

 

M.W.: Calculated molecular mass (kDa): 58.1; Estimated by SDS-PAGE under reducing condition (kDa): 75-85

 

Calculated PI: 8.76

 

Calculated extinction coefficients (M-1 cm-1, at 280nm):  72195

 

Purity: >90% judged by SDS-PAGE under reducing condition (see the gel image above, labeled as "S" and "M" for marker)

 

Formulation: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free).

 

Endotoxin Level: <0.1 EU per 1 μg of purified recombinant protein determined by the LAL method

 

Biological Activity: Inhibits the proliferation of HeLa human cervical epithelial carcinoma cells with an ED₅₀ of  0.2 - ­0.8 µg/mL 

 

 

  

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.

 

Storage

 

The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks.

 

 

Use a manual defrost freezer and avoid repeated freeze-thaw cycles.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

 

References

 

1. Proc. Natl. Acad. Sci. 94: 2859 (1997).

2. Proc. Natl. Acad. Sci. 94:6770 (1997).  

3. Oncogene 19:4210 (2000).  

4. J. Biol. Chem. 282:20523 (2007).

5. Stem Cells.  26: 35-44 (2008).

 

 

Documentation

 

Product datasheet (pdf) can be downloaded here: FCL1218-PDS.pdf

 

 

 

Additional supporting documents, including COA and MSDS are available upon request.

 

 

 

FOR RESEARCH USE ONLY. NOT FOR DIAGNOSTIC OR THERAPEUTIC USE IN HUMAN.

Restriction: This product is not transferable or re-sellable.  Customer obtain no right to transfer, assign, or sublicense its use rights, or to transfer, resell, package, or otherwise distribute the product, or to use the product for the benefit of any third party or for any commercial purpose.  Customer may only use the product in compliance with applicable local, state and federal laws, regulations and rules.  Customer may not directly or indirectly use the product or allow the transfer, transmission, export or re-export of all or any part of the product in violation of any export control law or regulation of the united states or any other relevant jurisdiction.  Your use of this product constitutes acceptance of the terms of this limited use agreement.  Please refer to our “terms & conditions” for details.  If you are not willing to accept the limitation of this agreement, G&P Biosciences will accept return of the product for a full/partial refund.